MSF (SEPT9) (NM_006640) Human Tagged ORF Clone

CAT#: RC200264

Reviews ()
Write a review

SEPT9 (Myc-DDK-tagged)-Human septin 9 (SEPT9), transcript variant 3



  "NM_006640" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 616.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SEPT9
Synonyms AF17q25; MSF; MSF1; NAPB; PNUTL4; SEPT9; SeptD1; SINT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200264 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGAGGGACCGGATCTCAGCCTTGAAAAGATCTTTTGAGGTCGAGGAGGTCGAGACACCCAACTCCA
CCCCACCCCGGAGGGTCCAGACTCCCCTACTCCGAGCCACTGTGGCCAGCTCCACCCAGAAATTCCAGGA
CCTGGGCGTGAAGAACTCAGAACCCTCGGCCCGCCATGTGGACTCCCTAAGCCAACGCTCCCCCAAGGCG
TCCCTGCGGAGGGTGGAGCTCTCGGGCCCCAAGGCGGCCGAGCCGGTGTCCCGGCGCACTGAGCTGTCCA
TTGACATCTCGTCCAAGCAGGTGGAGAACGCCGGGGCCATCGGCCCGTCCCGGTTCGGGCTCAAGAGGGC
CGAGGTGTTGGGCCACAAGACGCCAGAACCGGCCCCTCGGAGGACGGAGATCACCATCGTCAAACCCCAG
GAGTCAGCCCACCGGAGGATGGAGCCCCCTGCCTCCAAGGTCCCCGAGGTGCCCACTGCCCCTGCCACCG
ACGCAGCCCCCAAGAGGGTGGAGATCCAGATGCCCAAGCCTGCTGAGGCGCCCACCGCCCCCAGCCCAGC
CCAGACCTTGGAGAATTCAGAGCCTGCCCCTGTGTCTCAGCTGCAGAGCAGGCTGGAGCCCAAGCCCCAG
CCCCCTGTGGCTGAGGCTACACCCCGGAGCCAGGAGGCCACTGAGGCGGCTCCCAGCTGCGTTGGCGACA
TGGCCGACACCCCCAGAGATGCCGGGCTCAAGCAGGCGCCTGCATCACGGAACGAGAAGGCCCCGGTGGA
CTTCGGCTACGTGGGGATTGACTCCATCCTGGAGCAGATGCGCCGGAAGGCCATGAAGCAGGGCTTCGAG
TTCAACATCATGGTGGTCGGGCAGAGCGGCTTGGGTAAATCCACCTTAATCAACACCCTCTTCAAATCCA
AAATCAGCCGGAAGTCGGTGCAGCCCACCTCAGAGGAGCGCATCCCCAAGACCATCGAGATCAAGTCCAT
CACGCACGATATTGAGGAGAAAGGCGTCCGGATGAAGCTGACAGTGATTGACACACCAGGGTTCGGGGAC
CACATCAACAACGAGAACTGCTGGCAGCCCATCATGAAGTTCATCAATGACCAGTACGAGAAATACCTGC
AGGAGGAGGTCAACATCAACCGCAAGAAGCGCATCCCGGACACCCGCGTCCACTGCTGCCTCTACTTCAT
CCCCGCCACCGGCCACTCCCTCAGGCCCCTGGACATCGAGTTTATGAAACGCCTGAGCAAGGTGGTCAAC
ATCGTCCCTGTCATCGCCAAGGCGGACACACTCACCCTGGAGGAGAGGGTCCACTTCAAACAGCGGATCA
CCGCAGACCTGCTGTCCAACGGCATCGACGTGTACCCCCAGAAGGAATTTGATGAGGACTCGGAGGACCG
GCTGGTGAACGAGAAGTTCCGGGAGATGATCCCATTTGCTGTGGTGGGCAGTGACCACGAGTACCAGGTC
AACGGCAAGAGGATCCTTGGGAGGAAGACCAAGTGGGGTACCATCGAAGTTGAAAACACCACACACTGTG
AGTTTGCCTACCTGCGGGACCTTCTCATCAGGACGCACATGCAGAACATCAAGGACATCACCAGCAGCAT
CCACTTCGAGGCGTACCGTGTGAAGCGCCTCAACGAGGGCAGCAGCGCCATGGCCAACGGCGTGGAGGAG
AAGGAGCCAGAAGCCCCGGAGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200264 protein sequence
Red=Cloning site Green=Tags(s)

MERDRISALKRSFEVEEVETPNSTPPRRVQTPLLRATVASSTQKFQDLGVKNSEPSARHVDSLSQRSPKA
SLRRVELSGPKAAEPVSRRTELSIDISSKQVENAGAIGPSRFGLKRAEVLGHKTPEPAPRRTEITIVKPQ
ESAHRRMEPPASKVPEVPTAPATDAAPKRVEIQMPKPAEAPTAPSPAQTLENSEPAPVSQLQSRLEPKPQ
PPVAEATPRSQEATEAAPSCVGDMADTPRDAGLKQAPASRNEKAPVDFGYVGIDSILEQMRRKAMKQGFE
FNIMVVGQSGLGKSTLINTLFKSKISRKSVQPTSEERIPKTIEIKSITHDIEEKGVRMKLTVIDTPGFGD
HINNENCWQPIMKFINDQYEKYLQEEVNINRKKRIPDTRVHCCLYFIPATGHSLRPLDIEFMKRLSKVVN
IVPVIAKADTLTLEERVHFKQRITADLLSNGIDVYPQKEFDEDSEDRLVNEKFREMIPFAVVGSDHEYQV
NGKRILGRKTKWGTIEVENTTHCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGVEE
KEPEAPEM

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_006640
ORF Size 1704 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_006640.2, NP_006631.1
RefSeq Size 4469 bp
RefSeq ORF 1707 bp
Locus ID 10801
UniProt ID Q9UHD8
Cytogenetics 17q25.3
Domains GTP_CDC
Protein Families Druggable Genome
MW 63.6 kDa
Gene Summary This gene is a member of the septin family involved in cytokinesis and cell cycle control. This gene is a candidate for the ovarian tumor suppressor gene. Mutations in this gene cause hereditary neuralgic amyotrophy, also known as neuritis with brachial predilection. A chromosomal translocation involving this gene on chromosome 17 and the MLL gene on chromosome 11 results in acute myelomonocytic leukemia. Multiple alternatively spliced transcript variants encoding different isoforms have been described.[provided by RefSeq, Mar 2009]

Other Versions

Other products for "SEPT9"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00


SEPT9 mouse monoclonal antibody,clone OTI3G2
    • 100 ul

USD 417.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.