SCAMP2 (NM_005697) Human Tagged ORF Clone

CAT#: RC200262

Reviews ()
Write a review

SCAMP2 (Myc-DDK-tagged)-Human secretory carrier membrane protein 2 (SCAMP2)



  "NM_005697" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 517.00


Availability*
In Stock

Size
    • 10 ug


Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SCAMP2
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200262 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGCTTTCGACACCAACCCCTTCGCGGACCCAGTGGATGTAAACCCCTTCCAGGATCCCTCTGTGA
CCCAGCTGACCAACGCCCCGCAGGGCGGCCTGGCGGAATTCAACCCCTTCTCAGAGACAAATGCAGCGAC
AACAGTTCCTGTCACCCAACTCCCTGGGTCCTCACAGCCAGCGGTTCTCCAGCCATCAGTGGAACCAACC
CAGCCGACCCCCCAGGCCGTGGTGTCTGCAGCCCAGGCAGGCCTGCTCCGGCAGCAGGAAGAACTGGACA
GGAAAGCTGCCGAGCTGGAACGCAAGGAGCGGGAGCTGCAGAACACTGTAGCCAACTTGCATGTGAGACA
GAACAACTGGCCCCCTCTGCCCTCGTGGTGCCCTGTGAAGCCCTGCTTCTATCAGGATTTCTCCACAGAG
ATCCCTGCCGACTACCAGCGGATATGCAAGATGCTCTACTATCTGTGGATGTTGCATTCAGTGACTCTGT
TTCTGAACCTGCTTGCCTGCCTGGCCTGGTTCTCGGGCAACAGCTCCAAGGGAGTGGACTTTGGCCTCTC
CATCCTGTGGTTTCTGATCTTCACTCCCTGTGCCTTCCTTTGTTGGTACCGACCCATCTATAAGGCCTTT
AGGTCCGACAACTCTTTCAGCTTCTTTGTGTTCTTCTTTGTATTTTTTTGTCAAATAGGGATCTACATCA
TCCAGTTGGTTGGCATCCCTGGCCTGGGGGACAGCGGTTGGATTGCAGCCCTGTCTACACTGGATAATCA
TTCCCTGGCCATATCAGTCATCATGATGGTGGTGGCTGGCTTCTTCACCCTCTGTGCCGTGCTCTCAGTC
TTCCTCCTGCAGCGGGTGCACTCCCTCTACCGACGGACAGGGGCCAGCTTCCAGCAGGCCCAGGAGGAGT
TTTCCCAGGGCATCTTCAGCAGCAGAACCTTCCACAGAGCTGCTTCATCTGCTGCCCAAGGAGCCTTCCA
GGGGAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200262 protein sequence
Red=Cloning site Green=Tags(s)

MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT
QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE
IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF
RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV
FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_005697
ORF Size 987 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_005697.5
RefSeq Size 1313 bp
RefSeq ORF 990 bp
Locus ID 10066
UniProt ID O15127
Cytogenetics 15q24.1
Domains SCAMP
Protein Families Transmembrane
MW 36.6 kDa
Gene Summary This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]

Other Versions

Other products for "SCAMP2"
Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.