SCAMP2 (NM_005697) Human Tagged ORF Clone

CAT#: RC200262

SCAMP2 (Myc-DDK-tagged)-Human secretory carrier membrane protein 2 (SCAMP2)

Product Images

Circular map for RC200262

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Cat# PS100001, Left lane) or pCMV6-ENTRY SCAMP2 (Cat# RC200262, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SCAMP2(Cat# TA506991). Positive lysates LY417127 (100ug) and LC417127 (20ug) can be purchased separately from OriGene.

• 

  HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY SCAMP2 (RC200262, Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-SCAMP2 (TA506992). Positive lysates LY417127 (100ug) and LC417127 (20ug) can be purchased separately from OriGene.

• 

  Western blot validation of overexpression lysate (Cat# LY417127) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200262 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified SCAMP2 protein (Cat# TP300262). The protein was produced from HEK293T cells transfected with SCAMP2 cDNA clone (Cat# RC200262) using MegaTran 2.0 (Cat# TT210002).

• 

  Anti-SCAMP2 mouse monoclonal antibody (TA506992) immunofluorescent staining of COS7 cells transiently transfected by pCMV6-ENTRY SCAMP2 (RC200262).

Show all 6 images

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SCAMP2
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200262 ORF sequence
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCGGCTTTCGACACCAACCCCTTCGCGGACCCAGTGGATGTAAACCCCTTCCAGGATCCCTCTGTGA
  CCCAGCTGACCAACGCCCCGCAGGGCGGCCTGGCGGAATTCAACCCCTTCTCAGAGACAAATGCAGCGAC
  AACAGTTCCTGTCACCCAACTCCCTGGGTCCTCACAGCCAGCGGTTCTCCAGCCATCAGTGGAACCAACC
  CAGCCGACCCCCCAGGCCGTGGTGTCTGCAGCCCAGGCAGGCCTGCTCCGGCAGCAGGAAGAACTGGACA
  GGAAAGCTGCCGAGCTGGAACGCAAGGAGCGGGAGCTGCAGAACACTGTAGCCAACTTGCATGTGAGACA
  GAACAACTGGCCCCCTCTGCCCTCGTGGTGCCCTGTGAAGCCCTGCTTCTATCAGGATTTCTCCACAGAG
  ATCCCTGCCGACTACCAGCGGATATGCAAGATGCTCTACTATCTGTGGATGTTGCATTCAGTGACTCTGT
  TTCTGAACCTGCTTGCCTGCCTGGCCTGGTTCTCGGGCAACAGCTCCAAGGGAGTGGACTTTGGCCTCTC
  CATCCTGTGGTTTCTGATCTTCACTCCCTGTGCCTTCCTTTGTTGGTACCGACCCATCTATAAGGCCTTT
  AGGTCCGACAACTCTTTCAGCTTCTTTGTGTTCTTCTTTGTATTTTTTTGTCAAATAGGGATCTACATCA
  TCCAGTTGGTTGGCATCCCTGGCCTGGGGGACAGCGGTTGGATTGCAGCCCTGTCTACACTGGATAATCA
  TTCCCTGGCCATATCAGTCATCATGATGGTGGTGGCTGGCTTCTTCACCCTCTGTGCCGTGCTCTCAGTC
  TTCCTCCTGCAGCGGGTGCACTCCCTCTACCGACGGACAGGGGCCAGCTTCCAGCAGGCCCAGGAGGAGT
  TTTCCCAGGGCATCTTCAGCAGCAGAACCTTCCACAGAGCTGCTTCATCTGCTGCCCAAGGAGCCTTCCA
  GGGGAAT
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >RC200262 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSAFDTNPFADPVDVNPFQDPSVTQLTNAPQGGLAEFNPFSETNAATTVPVTQLPGSSQPAVLQPSVEPT
  QPTPQAVVSAAQAGLLRQQEELDRKAAELERKERELQNTVANLHVRQNNWPPLPSWCPVKPCFYQDFSTE
  IPADYQRICKMLYYLWMLHSVTLFLNLLACLAWFSGNSSKGVDFGLSILWFLIFTPCAFLCWYRPIYKAF
  RSDNSFSFFVFFFVFFCQIGIYIIQLVGIPGLGDSGWIAALSTLDNHSLAISVIMMVVAGFFTLCAVLSV
  FLLQRVHSLYRRTGASFQQAQEEFSQGIFSSRTFHRAASSAAQGAFQGN
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_005697
• ORF Size: 987 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_005697.5
• RefSeq Size: 1313 bp
• RefSeq ORF: 990 bp
• Locus ID: 10066
• UniProt ID: O15127
• Cytogenetics: 15q24.1
• Domains: SCAMP
• Protein Families: Transmembrane
• MW: 36.6 kDa
• Gene Summary: This gene product belongs to the SCAMP family of proteins which are secretory carrier membrane proteins. They function as carriers to the cell surface in post-golgi recycling pathways. Different family members are highly related products of distinct genes, and are usually expressed together. These findings suggest that the SCAMPs may function at the same site during vesicular transport rather than in separate pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]