HRASLS3 (PLA2G16) (NM_007069) Human Tagged ORF Clone

CAT#: RC200242

PLA2G16 (Myc-DDK-tagged)-Human phospholipase A2, group XVI (PLA2G16), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_007069" in other vectors (6)

Reconstitution Protocol

Special Offer: 20% off this product. Use code: "Clone20".

USD 150.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


PLA2G16 mouse monoclonal antibody, clone OTI1A5 (formerly 1A5)
    • 100 ul

USD 447.00

Other products for "HRASLS3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HRASLS3
Synonyms AdPLA; H-REV107; H-REV107-1; HRASLS3; HREV107; HREV107-1; HREV107-3; HRSL3; PLA2G16; PLAAT-3
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200242 representing NM_007069
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGTGCGCCCATTCCAGAGCCTAAGCCTGGAGACCTGATTGAGATTTTTCGCCCTTTCTACAGACACT
GGGCCATCTATGTTGGCGATGGATATGTGGTTCATCTGGCCCCTCCAAGTGAGGTCGCAGGAGCTGGTGC
AGCCAGTGTCATGTCCGCCCTGACTGACAAGGCCATCGTGAAGAAGGAATTGCTGTATGATGTGGCCGGG
AGTGACAAGTACCAGGTCAACAACAAACATGATGACAAGTACTCGCCGCTGCCCTGCAGCAAAATCATCC
AGCGGGCGGAGGAGCTGGTGGGGCAGGAGGTGCTCTACAAGCTGACCAGTGAGAACTGCGAGCACTTTGT
GAATGAGCTGCGCTATGGAGTCGCCCGCAGTGACCAGGTCAGAGATGTCATCATCGCTGCAAGCGTTGCA
GGAATGGGCTTGGCAGCCATGAGCCTTATTGGAGTCATGTTCTCAAGAAACAAGCGACAAAAGCAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200242 representing NM_007069
Red=Cloning site Green=Tags(s)

MRAPIPEPKPGDLIEIFRPFYRHWAIYVGDGYVVHLAPPSEVAGAGAASVMSALTDKAIVKKELLYDVAG
SDKYQVNNKHDDKYSPLPCSKIIQRAEELVGQEVLYKLTSENCEHFVNELRYGVARSDQVRDVIIAASVA
GMGLAAMSLIGVMFSRNKRQKQ

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_007069
ORF Size 486 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_007069.3
RefSeq Size 1070 bp
RefSeq ORF 489 bp
Locus ID 11145
UniProt ID P53816
Cytogenetics 11q12.3-q13.1
Domains NC
Protein Families Druggable Genome, Transmembrane
MW 17.9 kDa
Gene Summary Exhibits both phospholipase A1/2 and acyltransferase activities (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:26503625). Shows phospholipase A1 (PLA1) and A2 (PLA2) activity, catalyzing the calcium-independent release of fatty acids from the sn-1 or sn-2 position of glycerophospholipids (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381, PubMed:22923616). For most substrates, PLA1 activity is much higher than PLA2 activity (PubMed:19615464). Shows O-acyltransferase activity,catalyzing the transfer of a fatty acyl group from glycerophospholipid to the hydroxyl group of lysophospholipid (PubMed:19615464). Shows N-acyltransferase activity, catalyzing the calcium-independent transfer of a fatty acyl group at the sn-1 position of phosphatidylcholine (PC) and other glycerophospholipids to the primary amine of phosphatidylethanolamine (PE), forming N-acylphosphatidylethanolamine (NAPE), which serves as precursor for N-acylethanolamines (NAEs) (PubMed:19615464, PubMed:19047760, PubMed:22825852, PubMed:22605381). Exhibits high N-acyltransferase activity and low phospholipase A1/2 activity (PubMed:22825852).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.