Flotillin 1(FLOT1) (NM_005803) Human Tagged ORF Clone

CAT#: RC200231

FLOT1 (Myc-DDK-tagged)-Human flotillin 1 (FLOT1)

Change vector?

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Flotillin 1(FLOT1) (NM_005803) Human Tagged ORF Clone
Symbol FLOT1
Synonyms OTTHUMP00000029208; integral membrane component of caveolae; flotillin 1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200231 representing NM_005803
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTTTCACTTGTGGCCCAAATGAGGCCATGGTGGTCTCCGGGTTCTGCCGAAGCCCCCCAGTCATGG
TGGCTGGAGGGCGTGTCTTTGTCCTGCCCTGCATCCAACAGATCCAGAGGATCTCTCTCAACACACTGAC
CCTCAATGTCAAGAGTGAAAAGGTTTACACTCGCCATGGGGTCCCCATCTCAGTCACTGGCATTGCCCAG
GTAAAAATCCAGGGGCAGAACAAGGAGATGTTGGCGGCCGCCTGTCAGATGTTCCTGGGGAAGACGGAGG
CTGAGATTGCCCACATTGCCCTGGAGACGTTAGAGGGCCACCAGAGGGCCATCATGGCCCACATGACTGT
GGAGGAGATCTATAAGGACAGGCAGAAATTCTCAGAACAGGTTTTCAAAGTGGCCTCCTCAGACCTGGTC
AACATGGGCATCAGTGTGGTTAGCTACACTCTGAAGGACATTCACGATGACCAGGACTATTTGCACTCTT
TGGGGAAGGCTCGAACAGCTCAAGTCCAAAAAGATGCACGGATTGGAGAAGCAGAGGCCAAGAGAGATGC
TGGGATCCGGGAAGCTAAAGCCAAGCAGGAAAAGGTGTCTGCTCAGTACCTGAGTGAGATCGAGATGGCC
AAGGCACAGAGAGATTACGAACTGAAGAAGGCCGCCTATGACATCGAGGTCAACACCCGCCGAGCACAGG
CTGACCTGGCCTATCAGCTTCAGGTGGCCAAGACTAAGCAGCAGATTGAGGAGCAGCGGGTGCAGGTGCA
GGTGGTGGAGCGGGCCCAGCAGGTGGCAGTGCAGGAGCAGGAGATCGCCCGGCGGGAGAAGGAGCTGGAG
GCCCGGGTGCGGAAGCCAGCGGAAGCGGAGCGCTACAAGCTGGAGCGCCTAGCCGAGGCAGAGAAGTCCC
AACTAATTATGCAGGCGGAGGCAGAAGCCGCGTCTGTGCGGATGCGTGGGGAAGCTGAGGCCTTTGCCAT
AGGGGCCCGAGCCCGAGCCGAGGCTGAGCAGATGGCCAAGAAGGCAGAAGCCTTCCAGCTGTACCAAGAG
GCTGCTCAGCTGGACATGCTGCTAGAGAAGCTGCCCCAGGTGGCAGAGGAGATCAGTGGTCCCTTGACTT
CAGCCAATAAGATCACACTGGTGTCCAGCGGCAGTGGGACCATGGGGGCAGCCAAAGTGACTGGGGAAGT
ACTGGACATTCTAACTCGCCTGCCAGAGAGTGTGGAAAGACTCACAGGCGTGAGCATCTCCCAGGTGAAT
CACAAGCCTTTGAGAACAGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200231 representing NM_005803
Red=Cloning site Green=Tags(s)

MFFTCGPNEAMVVSGFCRSPPVMVAGGRVFVLPCIQQIQRISLNTLTLNVKSEKVYTRHGVPISVTGIAQ
VKIQGQNKEMLAAACQMFLGKTEAEIAHIALETLEGHQRAIMAHMTVEEIYKDRQKFSEQVFKVASSDLV
NMGISVVSYTLKDIHDDQDYLHSLGKARTAQVQKDARIGEAEAKRDAGIREAKAKQEKVSAQYLSEIEMA
KAQRDYELKKAAYDIEVNTRRAQADLAYQLQVAKTKQQIEEQRVQVQVVERAQQVAVQEQEIARREKELE
ARVRKPAEAERYKLERLAEAEKSQLIMQAEAEAASVRMRGEAEAFAIGARARAEAEQMAKKAEAFQLYQE
AAQLDMLLEKLPQVAEEISGPLTSANKITLVSSGSGTMGAAKVTGEVLDILTRLPESVERLTGVSISQVN
HKPLRTA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_005803
ORF Size 1281 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_005803.1, NM_005803.2, NM_005803.3, NP_005794
RefSeq Size 1839
Locus ID 10211
Cytogenetics 6p21.33
Domains Band_7, Flotillin
Protein Pathways Insulin signaling pathway
MW 47.2 kDa
Gene Summary May act as a scaffolding protein within caveolar membranes, functionally participating in formation of caveolae or caveolae-like vesicles. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.