MCM3 (NM_002388) Human Tagged ORF Clone

CAT#: RC200208

MCM3 (Myc-DDK-tagged)-Human minichromosome maintenance complex component 3 (MCM3)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_002388" in other vectors (4)

Reconstitution Protocol

USD 1,109.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Anti-MCM3 Rabbit Polyclonal Antibody
    • 100 ul

USD 380.00

Other products for "MCM3"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol MCM3
Synonyms HCC5; P1-MCM3; P1.h; RLFB
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200208 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGGTACCGTGGTGCTGGACGATGTGGAGCTGCGGGAGGCTCAGAGAGATTACCTGGACTTCCTGG
ACGACGAGGAAGACCAGGGAATTTATCAGAGCAAAGTTCGGGAGCTGATCAGTGACAACCAATACCGGCT
GATTGTCAATGTGAATGACCTGCGCAGGAAAAACGAGAAGAGGGCTAACCGGCTTCTGAACAATGCCTTT
GAGGAGCTGGTTGCCTTCCAGCGGGCCTTAAAGGATTTTGTGGCCTCCATTGATGCTACCTATGCCAAGC
AGTATGAGGAGTTCTACGTAGGACTGGAAGGCAGCTTTGGCTCCAAGCACGTCTCCCCGCGGACTCTTAC
CTCCTGCTTCCTCAGCTGTGTGGTCTGTGTGGAGGGCATTGTCACTAAATGTTCTCTAGTTCGTCCCAAA
GTCGTCCGCAGTGTCCACTACTGTCCTGCTACTAAGAAGACCATAGAGCGACGTTATTCTGATCTCACCA
CCCTGGTGGCCTTTCCCTCCAGCTCTGTCTATCCTACCAAGGATGAGGAGAACAATCCCCTTGAGACAGA
ATATGGCCTTTCTGTCTACAAGGATCACCAGACCATCACCATCCAGGAGATGCCGGAGAAGGCCCCAGCC
GGCCAGCTCCCCCGCTCTGTGGACGTCATTCTGGATGATGACTTGGTGGATAAAGCGAAGCCTGGTGACC
GGGTTCAGGTGGTGGGAACCTACCGTTGCCTTCCTGGAAAGAAGGGAGGCTACACCTCTGGGACCTTCAG
GACTGTCCTGATTGCCTGTAATGTTAAGCAGATGAGCAAGGATGCTCAGCCCTCTTTCTCTGCTGAGGAT
ATAGCCAAGATCAAGAAGTTCAGTAAAACCCGATCCAAGGATATCTTTGACCAGCTGGCCAAGTCATTGG
CCCCAAGTATCCATGGGCATGACTATGTCAAGAAAGCAATCCTCTGCTTGCTCTTGGGAGGGGTGGAACG
AGACCTAGAAAATGGCAGCCACATCCGTGGGGACATCAATATTCTTCTAATAGGAGACCCATCCGTTGCC
AAGTCTCAGCTTCTGCGGTATGTGCTTTGCACTGCACCCCGAGCTATCCCCACCACTGGCCGGGGCTCCT
CTGGAGTGGGTCTGACGGCTGCTGTCACCACAGACCAGGAAACAGGAGAGCGCCGTCTGGAAGCAGGGGC
CATGGTCCTGGCTGACCGAGGCGTGGTTTGCATTGATGAATTTGACAAAATGTCTGACATGGATCGCACA
GCCATCCATGAAGTGATGGAGCAGGGTCGAGTGACCATTGCCAAGGCTGGCATCCATGCTCGGCTGAATG
CCCGCTGCAGTGTTTTGGCAGCTGCCAACCCTGTCTACGGCAGGTATGACCAGTATAAGACTCCAATGGA
GAACATTGGGCTACAGGACTCACTGCTGTCACGATTTGACTTGCTCTTCATCATGCTGGATCAGATGGAT
CCTGAGCAGGATCGGGAGATCTCAGACCATGTCCTTCGGATGCACCGTTACAGAGCACCTGGGGAGCAGG
ATGGCGATGCTATGCCCTTGGGTAGTGCTGTGGATATCCTGGCCACAGATGATCCCAACTTTAGCCAGGA
AGATCAGCAGGACACCCAGATTTATGAGAAGCATGACAACCTTCTACATGGGACCAAGAAGAAAAAGGAG
AAGATGGTGAGTGCAGCATTCATGAAGAAGTACATCCATGTGGCCAAAATCATCAAGCCTGTCCTGACAC
AGGAGTCGGCCACCTACATTGCAGAAGAGTATTCACGCCTGCGCAGCCAGGATAGCATGAGCTCAGACAC
CGCCAGGACATCTCCAGTTACAGCCCGAACACTGGAAACTCTGATTCGACTGGCCACAGCCCATGCGAAG
GCCCGCATGAGCAAGACTGTGGACCTGCAGGATGCAGAGGAAGCTGTGGAGTTGGTCCAGTATGCTTACT
TTAAGAAGGTTCTGGAGAAGGAGAAGAAACGTAAGAAGCGAAGTGAGGATGAATCAGAGACAGAAGATGA
AGAGGAGAAAAGCCAAGAGGACCAGGAGCAGAAGAGGAAGAGAAGGAAGACTCGCCAGCCAGATGCCAAA
GATGGGGATTCATACGACCCCTATGACTTCAGTGACACAGAGGAGGAAATGCCTCAAGTACACACTCCAA
AGACGGCAGACTCACAGGAGACCAAGGAATCCCAGAAAGTGGAGTTGAGTGAATCCAGGTTGAAGGCATT
CAAGGTGGCCCTCTTGGATGTGTTCCGGGAAGCTCATGCGCAGTCAATCGGCATGAATCGCCTCACAGAA
TCCATCAACCGGGACAGCGAAGAGCCCTTCTCTTCAGTTGAGATCCAGGCTGCTCTGAGCAAGATGCAGG
ATGACAATCAGGTCATGGTGTCTGAGGGCATCATCTTCCTCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200208 protein sequence
Red=Cloning site Green=Tags(s)

MAGTVVLDDVELREAQRDYLDFLDDEEDQGIYQSKVRELISDNQYRLIVNVNDLRRKNEKRANRLLNNAF
EELVAFQRALKDFVASIDATYAKQYEEFYVGLEGSFGSKHVSPRTLTSCFLSCVVCVEGIVTKCSLVRPK
VVRSVHYCPATKKTIERRYSDLTTLVAFPSSSVYPTKDEENNPLETEYGLSVYKDHQTITIQEMPEKAPA
GQLPRSVDVILDDDLVDKAKPGDRVQVVGTYRCLPGKKGGYTSGTFRTVLIACNVKQMSKDAQPSFSAED
IAKIKKFSKTRSKDIFDQLAKSLAPSIHGHDYVKKAILCLLLGGVERDLENGSHIRGDINILLIGDPSVA
KSQLLRYVLCTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLADRGVVCIDEFDKMSDMDRT
AIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPVYGRYDQYKTPMENIGLQDSLLSRFDLLFIMLDQMD
PEQDREISDHVLRMHRYRAPGEQDGDAMPLGSAVDILATDDPNFSQEDQQDTQIYEKHDNLLHGTKKKKE
KMVSAAFMKKYIHVAKIIKPVLTQESATYIAEEYSRLRSQDSMSSDTARTSPVTARTLETLIRLATAHAK
ARMSKTVDLQDAEEAVELVQYAYFKKVLEKEKKRKKRSEDESETEDEEEKSQEDQEQKRKRRKTRQPDAK
DGDSYDPYDFSDTEEEMPQVHTPKTADSQETKESQKVELSESRLKAFKVALLDVFREAHAQSIGMNRLTE
SINRDSEEPFSSVEIQAALSKMQDDNQVMVSEGIIFLI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_002388
ORF Size 2424 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_002388.6
RefSeq Size 3234 bp
RefSeq ORF 2427 bp
Locus ID 4172
UniProt ID P25205
Cytogenetics 6p12.2
Domains MCM, AAA
Protein Families Druggable Genome, Stem cell - Pluripotency, Transcription Factors
Protein Pathways Cell cycle, DNA replication
MW 91 kDa
Gene Summary The protein encoded by this gene is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins. This protein is a subunit of the protein complex that consists of MCM2-7. It has been shown to interact directly with MCM5/CDC46. This protein also interacts with and is acetylated by MCM3AP, a chromatin-associated acetyltransferase. The acetylation of this protein inhibits the initiation of DNA replication and cell cycle progression. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2018]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.