DUS2L(DUS2) (NM_017803) Human Tagged ORF Clone

CAT#: RC200175

DUS2L (Myc-DDK-tagged)-Human dihydrouridine synthase 2-like, SMM1 homolog (S. cerevisiae) (DUS2L)

Change vector?

USD 98

USD 560


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DUS2L(DUS2) (NM_017803) Human Tagged ORF Clone
Symbol DUS2
Synonyms DUS2L; SMM1; URLC8
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200175 representing NM_017803
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATTTTGAATAGCCTCTCTCTGTGTTACCATAATAAGCTAATCCTGGCCCCAATGGTTCGGGTAGGGA
CTCTTCCAATGAGGCTGCTGGCCCTGGATTATGGAGCGGACATTGTTTACTGTGAGGAGCTGATCGACCT
CAAGATGATTCAGTGCAAGAGAGTTGTTAATGAGGTGCTCAGCACAGTGGACTTTGTCGCCCCTGATGAT
CGAGTTGTCTTCCGCACCTGTGAAAGAGAGCAGAACAGGGTGGTCTTCCAGATGGGGACTTCAGACGCAG
AGCGAGCCCTTGCTGTGGCCAGGCTTGTAGAAAATGATGTGGCTGGTATTGATGTCAACATGGGCTGTCC
AAAACAATATTCCACCAAGGGAGGAATGGGAGCTGCCCTGCTGTCAGACCCTGACAAGATTGAGAAGATC
CTCAGCACTCTTGTTAAAGGGACACGCAGACCTGTGACCTGCAAGATTCGCATCCTGCCATCGCTAGAAG
ATACCCTGAGCCTTGTGAAGCGGATAGAGAGGACTGGCATTGCTGCCATCGCAGTTCATGGGAGGAAGCG
GGAGGAGCGACCTCAGCATCCTGTCAGCTGTGAAGTCATCAAAGCCATTGCTGATACCCTCTCCATTCCT
GTCATAGCCAACGGAGGATCTCATGACCACATCCAACAGTATTCGGACATAGAGGACTTTCGACAAGCCA
CGGCAGCCTCTTCCGTGATGGTGGCCCGAGCAGCCATGTGGAACCCATCTATCTTCCTCAAGGAGGGTCT
GCGGCCCCTGGAGGAGGTCATGCAGAAATACATCAGATACGCGGTGCAGTATGACAACCACTACACCAAC
ACCAAGTACTGCTTGTGCCAGATGCTACGAGAACAGCTGGAGTCGCCCCAGGGAAGGTTGCTCCATGCTG
CCCAGTCTTCCCGGGAAATTTGTGAGGCCTTTGGCCTTGGTGCCTTCTATGAGGAGACCACACAGGAGCT
GGATGCCCAGCAGGCCAGGCTCTCAGCCAAGACTTCAGAGCAGACAGGGGAGCCAGCTGAAGATACCTCT
GGTGTCATTAAGATGGCTGTCAAGTTTGACCGGAGAGCATACCCAGCCCAGATCACCCCTAAGATGTGCC
TACTAGAGTGGTGCCGGAGGGAGAAGTTGGCACAGCCTGTGTATGAAACGGTTCAACGCCCTCTAGATCG
CCTGTTCTCCTCTATTGTCACCGTTGCTGAACAAAAGTATCAGTCTACCTTGTGGGACAAGTCCAAGAAA
CTGGCGGAGCAGGCTGCAGCCATCGTCTGTCTGCGGAGCCAGGGCCTCCCTGAGGGTCGGCTGGGTGAGG
AGAGCCCTTCCTTGCACAAGCGAAAGAGGGAGGCTCCTGACCAAGACCCTGGGGGCCCCAGAGCTCAGGA
GCTAGCACAACCTGGGGATCTGTGCAAGAAGCCCTTTGTGGCCTTGGGAAGTGGTGAAGAAAGCCCCCTG
GAAGGCTGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200175 representing NM_017803
Red=Cloning site Green=Tags(s)

MILNSLSLCYHNKLILAPMVRVGTLPMRLLALDYGADIVYCEELIDLKMIQCKRVVNEVLSTVDFVAPDD
RVVFRTCEREQNRVVFQMGTSDAERALAVARLVENDVAGIDVNMGCPKQYSTKGGMGAALLSDPDKIEKI
LSTLVKGTRRPVTCKIRILPSLEDTLSLVKRIERTGIAAIAVHGRKREERPQHPVSCEVIKAIADTLSIP
VIANGGSHDHIQQYSDIEDFRQATAASSVMVARAAMWNPSIFLKEGLRPLEEVMQKYIRYAVQYDNHYTN
TKYCLCQMLREQLESPQGRLLHAAQSSREICEAFGLGAFYEETTQELDAQQARLSAKTSEQTGEPAEDTS
GVIKMAVKFDRRAYPAQITPKMCLLEWCRREKLAQPVYETVQRPLDRLFSSIVTVAEQKYQSTLWDKSKK
LAEQAAAIVCLRSQGLPEGRLGEESPSLHKRKREAPDQDPGGPRAQELAQPGDLCKKPFVALGSGEESPL
EGW

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_017803
ORF Size 1479 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_017803.1, NM_017803.2, NM_017803.3, NM_017803.4, NP_060273
RefSeq Size 1999
RefSeq ORF 1482
Locus ID 54920
Cytogenetics 16q22.1
Domains dsrm, Dus
MW 54.9 kDa
Gene Summary This gene encodes a cytoplasmic protein that catalyzes the conversion of uridine residues to dihydrouridine in the D-loop of tRNA. The resulting modified bases confer enhanced regional flexibility to tRNA. The encoded protein may increase the rate of translation by inhibiting an interferon-induced protein kinase. This gene has been implicated in pulmonary carcinogenesis. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, Nov 2012]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations