SLC35C1 (NM_018389) Human Tagged ORF Clone

CAT#: RC200101

SLC35C1 (Myc-DDK-tagged)-Human solute carrier family 35, member C1 (SLC35C1), transcript variant 1

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_018389" in other vectors (6)

Reconstitution Protocol

USD 457.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


Rabbit Polyclonal Anti-SLC35C1 Antibody
    • 100 ul

USD 485.00

Other products for "SLC35C1"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SLC35C1
Synonyms CDG2C; FUCT1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200101 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATAGGGCCCCTCTGAAGCGGTCCAGGATCCTGCACATGGCGCTGACCGGGGCCTCAGACCCCTCTG
CAGAGGCAGAGGCCAACGGGGAGAAGCCCTTTCTGCTGCGGGCATTGCAGATCGCGCTGGTGGTCTCCCT
CTACTCGGTCACCTCCATCTCCATGGTGTTCCTTAATAAGTACCTGCTGGACAGCCCCTCCCTGCGGCTG
GACACCCCCATCTTCGTCACCTTCTACCAGTGCCTGGTGACCACGCTGCTGTGCAAAGGCCTCAGCGCTC
TGGCCGCCTGCTGCCCTGGTGCCGTGGACTTCCCCAGCTTGCGCCTGGACCTCAGGGTGGCCCGCAGCGT
CCTGCCCCTGTCGGTGGTCTTCATCGGCATGATCACCTTCAATAACCTCTGCCTCAAGTACGTCGGTGTG
GCCTTCTACAATGTGGGCCGCTCACTCACCACCGTCTTCAACGTGCTGCTCTCCTACCTGCTGCTCAAGC
AGACCACCTCCTTCTATGCCCTGCTCACCTGCGGTATCATCATCGGGGGCTTCTGGCTTGGTGTGGACCA
GGAGGGGGCAGAAGGCACCCTGTCGTGGCTGGGCACCGTCTTCGGCGTGCTGGCTAGCCTCTGTGTCTCG
CTCAACGCCATCTACACCACGAAGGTGCTCCCGGCGGTGGACGGCAGCATCTGGCGCCTGACTTTCTACA
ACAACGTCAACGCCTGCATCCTCTTCCTGCCCCTGCTCCTGCTGCTCGGGGAGCTTCAGGCCCTGCGTGA
CTTTGCCCAGCTGGGCAGTGCCCACTTCTGGGGGATGATGACGCTGGGCGGCCTGTTTGGCTTTGCCATC
GGCTACGTGACAGGACTGCAGATCAAGTTCACCAGTCCGCTGACCCACAATGTGTCGGGCACGGCCAAGG
CCTGTGCCCAGACAGTGCTGGCCGTGCTCTACTACGAGGAGACCAAGAGCTTCCTCTGGTGGACGAGCAA
CATGATGGTGCTGGGCGGCTCCTCCGCCTACACCTGGGTCAGGGGCTGGGAGATGAAGAAGACTCCGGAG
GAGCCCAGCCCCAAAGACAGCGAGAAGAGCGCCATGGGGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200101 protein sequence
Red=Cloning site Green=Tags(s)

MNRAPLKRSRILHMALTGASDPSAEAEANGEKPFLLRALQIALVVSLYSVTSISMVFLNKYLLDSPSLRL
DTPIFVTFYQCLVTTLLCKGLSALAACCPGAVDFPSLRLDLRVARSVLPLSVVFIGMITFNNLCLKYVGV
AFYNVGRSLTTVFNVLLSYLLLKQTTSFYALLTCGIIIGGFWLGVDQEGAEGTLSWLGTVFGVLASLCVS
LNAIYTTKVLPAVDGSIWRLTFYNNVNACILFLPLLLLLGELQALRDFAQLGSAHFWGMMTLGGLFGFAI
GYVTGLQIKFTSPLTHNVSGTAKACAQTVLAVLYYEETKSFLWWTSNMMVLGGSSAYTWVRGWEMKKTPE
EPSPKDSEKSAMGV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_018389
ORF Size 1092 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_018389.3, NP_060859.3
RefSeq Size 3531 bp
RefSeq ORF 1095 bp
Locus ID 55343
UniProt ID Q96A29
Cytogenetics 11p11.2
Protein Families Transmembrane
MW 39.7 kDa
Gene Summary This gene encodes a GDP-fucose transporter that is found in the Golgi apparatus. Mutations in this gene result in congenital disorder of glycosylation type IIc. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.