COX16 (NM_016468) Human Tagged ORF Clone

CAT#: RC200099

COX16 (Myc-DDK-tagged)-Human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), nuclear gene encoding mitochondrial protein, transcript variant 1

Change vector?

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name COX16 (NM_016468) Human Tagged ORF Clone
Symbol COX16
Synonyms C14orf112; HSPC203
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200099 representing NM_016468
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGCACCCGCGGTGATGCGTGCTTTTCGCAAGAACAAGACTCTCGGCTATGGAGTCCCCATGTTGT
TGCTGATTGTTGGAGGTTCTTTTGGTCTTCGTGAGTTTTCTCAAATCCGATATGATGCTGTGAAGAGTAA
AATGGATCCTGAGCTTGAAAAAAAACTGAAAGAGAATAAAATATCTTTAGAGTCGGAATATGAGAAAATC
AAAGACTCCAAGTTTGATGACTGGAAGAATATTCGAGGACCCAGGCCTTGGGAAGATCCTGACCTCCTCC
AAGGAAGAAATCCAGAAAGCCTTAAGACTAAGACAACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200099 representing NM_016468
Red=Cloning site Green=Tags(s)

MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI
KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016468
ORF Size 318 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016468.1, NM_016468.2, NM_016468.3, NM_016468.4, NM_016468.5, NM_016468.6, NP_057552
RefSeq Size 710
Locus ID 51241
Cytogenetics 14q24.2
Protein Families Secreted Protein, Transmembrane
MW 12.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.