COX16 (NM_016468) Human Tagged ORF Clone
CAT#: RC200099
COX16 (Myc-DDK-tagged)-Human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), nuclear gene encoding mitochondrial protein, transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
AAV Particle: DDK
"NM_016468" in other vectors (4)
USD 198.00
Specifications
Product Data | |
Type | Human Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | COX16 |
Synonyms | C14orf112; hCOX16; HSPC203 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>RC200099 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGTTTGCACCCGCGGTGATGCGTGCTTTTCGCAAGAACAAGACTCTCGGCTATGGAGTCCCCATGTTGT TGCTGATTGTTGGAGGTTCTTTTGGTCTTCGTGAGTTTTCTCAAATCCGATATGATGCTGTGAAGAGTAA AATGGATCCTGAGCTTGAAAAAAAACTGAAAGAGAATAAAATATCTTTAGAGTCGGAATATGAGAAAATC AAAGACTCCAAGTTTGATGACTGGAAGAATATTCGAGGACCCAGGCCTTGGGAAGATCCTGACCTCCTCC AAGGAAGAAATCCAGAAAGCCTTAAGACTAAGACAACT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >RC200099 protein sequence
Red=Cloning site Green=Tags(s) MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKI KDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_016468 |
ORF Size | 318 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_016468.7 |
RefSeq Size | 1724 bp |
RefSeq ORF | 321 bp |
Locus ID | 51241 |
UniProt ID | Q9P0S2 |
Cytogenetics | 14q24.2 |
Protein Families | Secreted Protein, Transmembrane |
MW | 12.3 kDa |
Gene Summary | Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase (PubMed:29355485, PubMed:29381136). Promotes the insertion of copper into the active site of cytochrome c oxidase subunit II (MT-CO2/COX2) (PubMed:29355485, PubMed:29381136). Interacts specifically with newly synthesized MT-CO2/COX and its copper center-forming metallochaperones SCO1, SCO2 and COA6 (PubMed:29381136). Probably facilitates MT-CO2/COX2 association with the MITRAC assembly intermediate containing MT-CO1/COX1, thereby participating in merging the MT-CO1/COX1 and MT-CO2/COX2 assembly lines (PubMed:29381136).[UniProtKB/Swiss-Prot Function] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
RC200099L3 | Lenti ORF clone of Human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), nuclear gene encoding mitochondrial protein, transcript variant 1, Myc-DDK-tagged |
USD 450.00 |
|
RC200099L4 | Lenti ORF clone of Human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), nuclear gene encoding mitochondrial protein, transcript variant 1, mGFP tagged |
USD 450.00 |
|
RG200099 | COX16 (tGFP-tagged) - Human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 350.00 |
|
SC114236 | COX16 (untagged)-Human COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) (COX16), nuclear gene encoding mitochondrial protein, transcript variant 1 |
USD 150.00 |
{0} Product Review(s)
Be the first one to submit a review