SKIP(INPP5K) (NM_016532) Human Tagged ORF Clone

CAT#: RC200092

INPP5K (Myc-DDK-tagged)-Human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1

Change vector?

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name SKIP(INPP5K) (NM_016532) Human Tagged ORF Clone
Symbol INPP5K
Synonyms PPS; SKIP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200092 representing NM_016532
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCTCGCGGAAGCTGAGCGGGCCGAAAGGCAGGAGGCTCAGCATACACGTCGTGACTTGGAACGTGG
CTTCGGCAGCGCCCCCTCTAGATCTCAGTGACCTGCTTCAGCTGAACAACCGGAACCTCAATCTTGACAT
ATATGTTATTGGTTTGCAGGAATTGAACTCTGGGATCATAAGCCTCCTTTCCGATGCTGCCTTTAATGAC
TCGTGGAGCAGTTTCCTCATGGATGTGCTTTCCCCTCTGAGCTTCATCAAGGTCTCCCATGTCCGTATGC
AGGGGATCCTCTTACTGGTCTTTGCCAAGTATCAGCATTTGCCCTATATCCAGATTCTGTCTACTAAATC
CACCCCCACTGGCCTGTTTGGGTACTGGGGGAACAAAGGTGGAGTCAACATCTGCCTGAAGCTTTATGGC
TACTATGTCAGCATCATCAACTGCCACCTGCCTCCCCACATTTCCAACAATTACCAGCGGCTGGAGCACT
TTGACCGGATCCTGGAGATGCAGAATTGTGAGGGGCGAGACATCCCAAACATCCTGGACCACGACCTCAT
TATCTGGTTTGGAGACATGAACTTTCGGATCGAGGACTTTGGGTTGCACTTTGTTCGGGAATCCATTAAA
AATCGGTGCTACGGTGGCCTGTGGGAGAAGGACCAGCTCAGCATTGCCAAGAAACATGACCCGCTGCTCC
GGGAGTTCCAGGAGGGCCGCCTACTCTTCCCGCCCACCTACAAGTTTGATAGGAACTCCAACGACTATGA
CACCAGTGAGAAAAAACGCAAGCCTGCATGGACCGATCGCATCCTGTGGAGGCTGAAGCGGCAGCCCTGT
GCTGGCCCCGACACTCCCATACCGCCGGCGTCACACTTCTCCTTGTCTCTGAGGGGCTACAGCAGCCACA
TGACGTACGGCATCAGCGACCACAAGCCTGTCTCCGGCACGTTCGACTTGGAGCTGAAGCCATTGGTGTC
TGCTCCGCTGATCGTCCTGATGCCCGAGGACCTGTGGACCGTGGAAAATGACATGATGGTCAGCTACTCT
TCAACCTCGGACTTCCCCAGCAGCCCGTGGGACTGGATTGGACTGTACAAGGTGGGGCTGCGGGACGTTA
ATGACTACGTGTCCTATGCCTGGGTCGGGGACAGCAAGGTCTCCTGCAGCGACAACCTGAACCAGGTTTA
CATCGACATCAGCAATATCCCTACCACTGAAGATGAGTTTCTCCTCTGTTACTACAGCAACAGTCTGCGT
TCTGTGGTGGGGATAAGCAGACCCTTCCAGATCCCGCCTGGCTCCTTGAGGGAGGACCCACTGGGTGAAG
CACAGCCACAGATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200092 representing NM_016532
Red=Cloning site Green=Tags(s)

MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND
SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG
YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK
NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC
AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS
STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR
SVVGISRPFQIPPGSLREDPLGEAQPQI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016532
ORF Size 1344 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016532.1, NM_016532.2, NM_016532.3, NP_057616
RefSeq Size 2773
Locus ID 51763
Cytogenetics 17p13.3
Domains IPPc, Exo_endo_phos
Protein Families Phosphatase, Druggable Genome
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system, Insulin signaling pathway
MW 50.9 kDa
Gene Summary This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.