ZAK(ZAK) (NM_133646) Human Tagged ORF Clone

CAT#: RC200069

ZAK (Myc-DDK-tagged)-Human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2

Change vector?

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ZAK(ZAK) (NM_133646) Human Tagged ORF Clone
Symbol ZAK
Synonyms AZK; MLK7; mlklak; MLT; MLTK; MRK; pk; SFMMP
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200069 representing NM_133646
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGTCTCTCGGTGCCTCCTTTGTGCAAATTAAATTTGATGACTTGCAGTTTTTTGAAAACTGCGGTG
GAGGAAGTTTTGGGAGTGTTTATCGAGCCAAATGGATATCACAGGACAAGGAGGTGGCTGTAAAGAAGCT
CCTCAAAATAGAGAAAGAGGCAGAAATACTCAGTGTCCTCAGTCACAGAAACATCATCCAGTTTTATGGA
GTAATTCTTGAACCTCCCAACTATGGCATTGTCACAGAATATGCTTCTCTGGGATCACTCTATGATTACA
TTAACAGTAACAGAAGTGAGGAGATGGATATGGATCACATTATGACCTGGGCCACTGATGTAGCCAAAGG
AATGCATTATTTACATATGGAGGCTCCTGTCAAGGTGATTCACAGAGACCTCAAGTCAAGAAACGTTGTT
ATAGCTGCTGATGGAGTATTGAAGATCTGTGACTTTGGTGCCTCTCGGTTCCATAACCATACAACACACA
TGTCCTTGGTTGGAACTTTCCCATGGATGGCTCCAGAAGTTATCCAGAGTCTCCCTGTGTCAGAAACTTG
TGACACATATTCCTATGGTGTGGTTCTCTGGGAGATGCTAACAAGGGAGGTCCCCTTTAAAGGTTTGGAA
GGATTACAAGTAGCTTGGCTTGTAGTGGAAAAAAACGAGAGATTAACCATTCCAAGCAGTTGCCCCAGAA
GTTTTGCTGAACTGTTACATCAGTGTTGGGAAGCTGATGCCAAGAAACGGCCATCATTCAAGCAAATCAT
TTCAATCCTGGAGTCCATGTCAAATGACACGAGCCTTCCTGACAAGTGTAACTCATTCCTACACAACAAG
GCGGAGTGGAGGTGCGAAATTGAGGCAACTCTTGAGAGGCTAAAGAAACTAGAGCGTGATCTCAGCTTTA
AGGAGCAGGAGCTTAAAGAACGAGAAAGACGTTTAAAGATGTGGGAGCAAAAGCTGACAGAGCAGTCCAA
CACCCCGCTTCTCTTGCCTCTTGCTGCAAGAATGTCTGAGGAGTCTTACTTTGAATCTAAAACAGAGGAG
TCAAACAGTGCAGAGATGTCATGTCAGATCACAGCAACAAGTAACGGGGAGGGCCATGGCATGAACCCAA
GTCTGCAGGCCATGATGCTGATGGGCTTTGGGGATATCTTCTCAATGAACAAAGCAGGAGCTGTGATGCA
TTCTGGGATGCAGATAAACATGCAAGCCAAGCAGAATTCTTCCAAAACCACATCTAAGAGAAGGGGGAAG
AAAGTCAACATGGCTCTGGGGTTCAGTGATTTTGACTTGTCAGAAGGTGACGATGATGATGATGATGACG
GTGAGGAGGAGGATAATGACATGGATAATAGTGAA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200069 representing NM_133646
Red=Cloning site Green=Tags(s)

MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG
VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV
IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE
GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK
AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEE
SNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGK
KVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_133646
ORF Size 1365 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_133646.1, NM_133646.2, NP_598407
RefSeq Size 7194
Locus ID 51776
Cytogenetics 2q31.1
Domains pkinase, TyrKc, S_TKc
Protein Families Protein Kinase, Druggable Genome
Protein Pathways MAPK signaling pathway, Tight junction
MW 51.4 kDa
Gene Summary This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.