NFYC (NM_014223) Human Tagged ORF Clone

CAT#: RC200060

NFYC (Myc-DDK-tagged)-Human nuclear transcription factor Y, gamma (NFYC), transcript variant 2

Change vector?

USD 98

USD 560


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name NFYC (NM_014223) Human Tagged ORF Clone
Symbol NFYC
Synonyms CBF-C; CBFC; H1TF2A; HAP5; HSM; NF-YC
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200060 representing NM_014223
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCCACAGAAGGAGGATTTGGTGGTACTAGCAGCAGTGATGCCCAGCAAAGCCTACAGTCGTTCTGGC
CTCGGGTCATGGAAGAAATCCGGAATTTAACAGTGAAAGACTTCCGAGTGCAGGAACTCCCACTGGCTCG
TATTAAGAAGATTATGAAACTGGATGAAGATGTGAAGATGATCAGTGCAGAAGCGCCTGTACTCTTTGCC
AAGGCAGCCCAGATTTTTATCACAGAGTTGACTCTTCGAGCCTGGATTCACACAGAAGATAACAAGCGCC
GGACTCTACAGAGAAATGATATCGCCATGGCAATTACAAAATTTGATCAGTTTGATTTTCTCATCGATAT
TGTTCCAAGAGATGAACTGAAACCTCCAAAGCGTCAGGAGGAGGTGCGCCAGTCTGTAACTCCTGCCGAG
CCAGTCCAGTACTATTTCACGCTGGCTCAGCAACCCACCGCTGTCCAAGTCCAGGGCCAGCAGCAAGGCC
AGCAGACCACCAGCTCCACGACCACCATCCAGCCTGGGCAGATCATCATCGCACAGCCTCAGCAGGGCCA
GACCACACCTGTGACAATGCAGGTTGGAGAAGGTCAGCAGGTGCAGATTGTCCAGGCTCAGCCACAGGGT
CAAGCCCAACAGGCCCAGAGTGGCACTGGACAGACCATGCAGGTGATGCAGCAGATCATCACTAACACAG
GAGAGATCCAGCAGATCCCGGTGCAGCTGAATGCCGGCCAGCTGCAGTATATCCGCTTAGCCCAGCCTGT
ATCAGGCACTCAAGTTGTGCAGGGACAGATCCAGACACTTGCCACCAATGCTCAACAGATTACACAGACA
GAGGTCCAGCAAGGACAGCAGCAGTTCAGCCAGTTCACAGATGGACAGCAGCTCTACCAGATCCAGCAAG
TCACCATGCCTGCGGGCCAGGACCTCGCCCAGCCCATGTTCATCCAGTCAGCCAACCAGCCCTCCGACGG
GCAGGCCCCCCAGGTGACCGGCGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200060 representing NM_014223
Red=Cloning site Green=Tags(s)

MSTEGGFGGTSSSDAQQSLQSFWPRVMEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFA
KAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPRDELKPPKRQEEVRQSVTPAE
PVQYYFTLAQQPTAVQVQGQQQGQQTTSSTTTIQPGQIIIAQPQQGQTTPVTMQVGEGQQVQIVQAQPQG
QAQQAQSGTGQTMQVMQQIITNTGEIQQIPVQLNAGQLQYIRLAQPVSGTQVVQGQIQTLATNAQQITQT
EVQQGQQQFSQFTDGQQLYQIQQVTMPAGQDLAQPMFIQSANQPSDGQAPQVTGD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014223
ORF Size 1005 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014223.1, NM_014223.2, NM_014223.3, NM_014223.4, NP_055038
RefSeq Size 1965
RefSeq ORF 1008
Locus ID 4802
Cytogenetics 1p34.2
Domains CBFD_NFYB_HMF
Protein Families Transcription Factors
Protein Pathways Antigen processing and presentation
MW 37 kDa
Gene Summary Component of the sequence-specific heterotrimeric transcription factor (NF-Y) which specifically recognizes a 5'-CCAAT-3' box motif found in the promoters of its target genes. NF-Y can function as both an activator and a repressor, depending on its interacting cofactors. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.