PPP2R1A (NM_014225) Human Tagged ORF Clone

CAT#: RC200056

Reviews ()
Write a review

PPP2R1A (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit A, alpha (PPP2R1A), transcript variant 1


  "NM_014225" in other vectors (7)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name PPP2R1A (NM_014225) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol PPP2R1A
Synonyms MRD36; PP2A-Aalpha; PP2AA; PP2AAALPHA; PR65A
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200056 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCGGCGGCCGACGGCGACGACTCGCTGTACCCCATCGCGGTGCTCATAGACGAACTCCGCAATGAGG
ACGTTCAGCTTCGCCTCAACAGCATCAAGAAGCTGTCCACCATCGCCTTGGCCCTTGGGGTTGAAAGGAC
CCGAAGTGAGCTTCTGCCTTTCCTTACAGATACCATCTATGATGAAGATGAGGTCCTCCTGGCCCTGGCA
GAACAGCTGGGAACCTTCACTACCCTGGTGGGAGGCCCAGAGTACGTGCACTGCCTGCTGCCACCGCTGG
AGTCGCTGGCCACAGTGGAGGAGACAGTGGTGCGGGACAAGGCAGTGGAGTCCTTACGGGCCATCTCACA
CGAGCACTCGCCCTCTGACCTGGAGGCGCACTTTGTGCCGCTAGTGAAGCGGCTGGCGGGCGGCGACTGG
TTCACCTCCCGCACCTCGGCCTGCGGCCTCTTCTCCGTCTGCTACCCCCGAGTGTCCAGTGCTGTGAAGG
CGGAACTTCGACAGTACTTCCGGAACCTGTGCTCAGATGACACCCCCATGGTGCGGCGGGCCGCAGCCTC
CAAGCTGGGGGAGTTTGCCAAGGTGCTGGAGCTGGACAACGTCAAGAGTGAGATCATCCCCATGTTCTCC
AACCTGGCCTCTGACGAGCAGGACTCGGTGCGGCTGCTGGCGGTGGAGGCGTGCGTGAACATCGCCCAGC
TTCTGCCCCAGGAGGATCTGGAGGCCCTGGTGATGCCCACTCTGCGCCAGGCCGCTGAAGACAAGTCCTG
GCGCGTCCGCTACATGGTGGCTGACAAGTTCACAGAGCTCCAGAAAGCAGTGGGGCCTGAGATCACCAAG
ACAGACCTGGTCCCTGCCTTCCAGAACCTGATGAAAGACTGTGAGGCCGAGGTGAGGGCCGCAGCCTCCC
ACAAGGTCAAAGAGTTCTGTGAAAACCTCTCAGCTGACTGTCGGGAGAATGTGATCATGTCCCAGATCTT
GCCCTGCATCAAGGAGCTGGTGTCCGATGCCAACCAACATGTCAAGTCTGCCCTGGCCTCAGTCATCATG
GGTCTCTCTCCCATCTTGGGCAAAGACAACACCATCGAGCACCTCTTGCCCCTCTTCCTGGCTCAGCTGA
AGGATGAGTGCCCTGAGGTACGGCTGAACATCATCTCTAACCTGGACTGTGTGAACGAGGTGATTGGCAT
CCGGCAGCTGTCCCAGTCCCTGCTCCCTGCCATTGTGGAGCTGGCTGAGGACGCCAAGTGGCGGGTGCGG
CTGGCCATCATTGAGTACATGCCCCTCCTGGCTGGACAGCTGGGAGTGGAGTTCTTTGATGAGAAACTTA
ACTCCTTGTGCATGGCCTGGCTTGTGGATCATGTATATGCCATCCGCGAGGCAGCCACCAGCAACCTGAA
GAAGCTAGTGGAAAAGTTTGGGAAGGAGTGGGCCCATGCCACAATCATCCCCAAGGTCTTGGCCATGTCC
GGAGACCCCAACTACCTGCACCGCATGACTACGCTCTTCTGCATCAATGTGCTGTCTGAGGTCTGTGGGC
AGGACATCACCACCAAGCACATGCTACCCACGGTTCTGCGCATGGCTGGGGACCCGGTTGCCAATGTCCG
CTTCAATGTGGCCAAGTCTCTGCAGAAGATAGGGCCCATCCTGGACAACAGCACCTTGCAGAGTGAAGTC
AAGCCCATCCTAGAGAAGCTGACCCAGGACCAGGATGTGGACGTCAAATACTTTGCCCAGGAGGCTCTGA
CTGTTCTGTCTCTCGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200056 protein sequence
Red=Cloning site Green=Tags(s)

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALA
EQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDW
FTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFS
NLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITK
TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIM
GLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMS
GDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEV
KPILEKLTQDQDVDVKYFAQEALTVLSLA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_014225
ORF Size 1767 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_014225.1, NM_014225.2, NM_014225.3, NM_014225.4, NM_014225.5, NP_055040.2
RefSeq Size 2519
RefSeq ORF 1770
Locus ID 5518
Cytogenetics 19q13.41
Domains HEAT, HEAT_PBS
Protein Families Druggable Genome, Phosphatase, Transcription Factors
Protein Pathways Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway
MW 65.3 kDa
Gene Summary This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described. [provided by RefSeq, Apr 2010]

Other Versions

Other products for "PPP2R1A"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Goat Anti-PP2A / PPP2R1A Antibody
    • 100 ug

USD 375.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools