GIT2 (NM_139201) Human Tagged ORF Clone

CAT#: RC200045

GIT2 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 2 (GIT2), transcript variant 4

Change vector?

USD 98

USD 560


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name GIT2 (NM_139201) Human Tagged ORF Clone
Symbol GIT2
Synonyms CAT-2; CAT2; PKL
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200045 representing NM_139201
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGAAACGGCTCCGGAGCAGCGAGGTGTGCGCTGACTGCAGCGGGCCGGATCCTTCCTGGGCATCAG
TAAATAGGGGAACGTTTTTATGTGATGAGTGCTGCAGTGTCCATCGGAGTCTAGGGCGCCATATCTCCCA
AGTGAGGCATCTGAAACACACACCGTGGCCTCCAACACTGCTTCAGATGGTTGAGACCTTGTATAATAAC
GGTGCTAACTCTATATGGGAGCATTCTTTGCTGGACCCTGCGTCTATTATGAGTGGAAGACGTAAAGCTA
ATCCACAGGATAAAGTACATCCCAATAAAGCGGAATTCATCAGAGCCAAGTATCAGATGTTAGCGTTCGT
CCATCGCTTGCCCTGCCGGGATGACGATAGTGTGACTGCCAAAGATCTTAGCAAGCAACTCCATTCGAGC
GTGAGAACAGGGAATCTTGAAACCTGTTTGAGACTGTTATCTTTAGGAGCACAAGCCAACTTCTTTCATC
CTGAAAAAGGAAACACCCCACTCCATGTTGCCTCCAAAGCAGGGCAGATTTTACAGGCTGAATTATTGGC
AGTATATGGAGCAGACCCAGGCACACAGGATTCTAGTGGGAAAACTCCCGTTGATTATGCAAGGCAAGGA
GGGCACCATGAGCTGGCAGAGCGCCTCGTGGAAATACAGTATGAGCTAACGGACAGACTAGCCTTCTATC
TCTGTGGCAGGAAACCAGATCACAAAAATGGACAGCACTTTATAATACCTCAAATGGCAGACAGCAGCCT
GGATTTGTCTGAATTGGCAAAAGCTGCTAAGAAGAAACTTCAATCTCTAAGTAATCATTTGTTTGAAGAA
CTTGCCATGGATATGTACGATGAAGTTGACAGGCGAGAGACGGATGCAGTCTGGCTTGCCACGCAAAACC
ACAGCGCCCTGGTAACCGAGACAACGGTCGTCCCCTTTCTTCCGGTCAATCCTGAGTACTCATCAACACG
AAATCAGGGCAGACAGAAGTTAGCTCGGTTCAACGCCCATGAGTTTGCCACGCTGGTCATTGACATTCTC
AGTGACGCCAAGAGGAGACAGCAGGGCAGTTCTCTCTCGGGTTCAAAAGACAATGTGGAGCTCATACTGA
AAACCATCAATAACCAGCACAGCGTTGAGAGTCAAGACAACGATCAGCCCGACTATGACAGCGTGGCATC
AGACGAAGACACAGATTTGGAAACCACTGCAAGCAAAACAAACCGGCAGAAGAGCCTAGATTCAGATTTA
TCAGATGGACCAGTCACTGTACAGGAATTTATGGAGGTCAAAAACGCTCTAGTGGCTTCTGAGGCCAAGA
TACAGCAGCTAATGAAGGTGAATAACAACTTGAGTGACGAGCTGAGAATTATGCAGAAAAAGTTGCTTGG
AAAAGATGCTAAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200045 representing NM_139201
Red=Cloning site Green=Tags(s)

MSKRLRSSEVCADCSGPDPSWASVNRGTFLCDECCSVHRSLGRHISQVRHLKHTPWPPTLLQMVETLYNN
GANSIWEHSLLDPASIMSGRRKANPQDKVHPNKAEFIRAKYQMLAFVHRLPCRDDDSVTAKDLSKQLHSS
VRTGNLETCLRLLSLGAQANFFHPEKGNTPLHVASKAGQILQAELLAVYGADPGTQDSSGKTPVDYARQG
GHHELAERLVEIQYELTDRLAFYLCGRKPDHKNGQHFIIPQMADSSLDLSELAKAAKKKLQSLSNHLFEE
LAMDMYDEVDRRETDAVWLATQNHSALVTETTVVPFLPVNPEYSSTRNQGRQKLARFNAHEFATLVIDIL
SDAKRRQQGSSLSGSKDNVELILKTINNQHSVESQDNDQPDYDSVASDEDTDLETTASKTNRQKSLDSDL
SDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLLGKDAN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_139201
ORF Size 1413 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_139201.1, NM_139201.2, NP_631940
RefSeq Size 2264
RefSeq ORF 1416
Locus ID 9815
Cytogenetics 12q24.11
Domains ArfGap, ank
Protein Families Druggable Genome
Protein Pathways Endocytosis
MW 52.4 kDa
Gene Summary This gene encodes a member of the GIT protein family, which interact with G protein-coupled receptor kinases and possess ADP-ribosylation factor (ARF) GTPase-activating protein (GAP) activity. GIT proteins traffic between cytoplasmic complexes, focal adhesions, and the cell periphery, and interact with Pak interacting exchange factor beta (PIX) to form large oligomeric complexes that transiently recruit other proteins. GIT proteins regulate cytoskeletal dynamics and participate in receptor internalization and membrane trafficking. This gene has been shown to repress lamellipodial extension and focal adhesion turnover, and is thought to regulate cell motility. This gene undergoes extensive alternative splicing to generate multiple isoforms, but the full-length nature of some of these variants has not been determined. The various isoforms have functional differences, with respect to ARF GAP activity and to G protein-coupled receptor kinase 2 binding. [provided by RefSeq, Sep 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.