HEMK1 (NM_016173) Human Tagged ORF Clone

CAT#: RC200039

Reviews ()
Write a review

HEMK1 (Myc-DDK-tagged)-Human HemK methyltransferase family member 1 (HEMK1)


  "NM_016173" in other vectors (4)

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name HEMK1 (NM_016173) Human Tagged ORF Clone
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol HEMK1
Synonyms HEMK; MTQ1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>RC200039 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGCTTTGGGGCCGAATGCTGTGGGCCCTCCTGTCTGGCCCAGGGAGGAGGGGAAGTACCCGGGGCT
GGGCCTTCAGCTCATGGCAACCCCAACCACCTCTGGCTGGGTTATCCAGTGCCATAGAACTGGTCAGCCA
CTGGACTGGGGTCTTTGAGAAGAGGGGTATCCCTGAGGCCCGGGAATCCAGTGAGTACATCGTGGCTCAT
GTCCTTGGAGCCAAAACATTTCAGAGCCTGAGGCCGGCACTTTGGACCCAGCCCTTGACCTCTCAGCAAC
TACAGTGTATCCGGGAGCTGAGTAGCCGTCGATTGCAGAGGATGCCGGTGCAGTACATCCTTGGAGAGTG
GGACTTCCAGGGGCTCAGCCTAAGGATGGTGCCCCCAGTGTTTATTCCGCGGCCAGAAACAGAGGAACTG
GTTGAGTGGGTGCTGGAAGAGGTGGCCCAGAGGTCCCATGCTGTGGGATCCCCAGGCAGCCCCCTCATTC
TGGAGGTGGGCTGCGGATCAGGAGCCATCTCCCTCAGCCTGCTGAGCCAGCTCCCCCAGAGCCGAGTCAT
TGCTGTGGATAAGCGGGAAGCTGCTATCTCTCTGACCCATGAGAATGCTCAGAGGCTTCGGTTGCAGGAC
AGGATTTGGATCATCCACCTCGACATGACCTCAGAAAGGAGCTGGACACACCTGCCCTGGGGCCCCATGG
ACCTGATTGTCAGCAACCCTCCCTACGTCTTCCACCAGGACATGGAGCAGCTGGCCCCTGAGATCCGCAG
CTATGAAGACCCCGCGGCCCTGGATGGTGGGGAGGAGGGCATGGACATCATTACCCACATTCTGGCCTTG
GCACCCCGGCTCCTGAAAGACTCTGGTAGTATCTTCTTAGAAGTGGACCCAAGGCACCCGGAGCTTGTCA
GCAGCTGGCTTCAGAGCCGGCCTGACCTGTACCTTAATCTTGTGGCTGTGCGCAGGGACTTCTGTGGGAG
GCCCCGGTTCCTGCATATCCGGAGGTCTGGGCCA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200039 protein sequence
Red=Cloning site Green=Tags(s)

MELWGRMLWALLSGPGRRGSTRGWAFSSWQPQPPLAGLSSAIELVSHWTGVFEKRGIPEARESSEYIVAH
VLGAKTFQSLRPALWTQPLTSQQLQCIRELSSRRLQRMPVQYILGEWDFQGLSLRMVPPVFIPRPETEEL
VEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHENAQRLRLQD
RIWIIHLDMTSERSWTHLPWGPMDLIVSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILAL
APRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCGRPRFLHIRRSGP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016173
ORF Size 1014 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016173.1, NM_016173.2, NM_016173.3, NM_016173.4, NP_057257.1
RefSeq Size 5862
RefSeq ORF 1017
Locus ID 51409
Cytogenetics 3p21.31
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism
MW 38.2 kDa

Other Versions

Other products for "HEMK1"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 310.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones
Molbio tools