ELOVL1 (NM_022821) Human Tagged ORF Clone

CAT#: RC200027

ELOVL1 (Myc-DDK-tagged)-Human ELOVL fatty acid elongase 1 (ELOVL1)

Change vector?

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name ELOVL1 (NM_022821) Human Tagged ORF Clone
Symbol ELOVL1
Synonyms CGI-88; Ssc1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200027 representing NM_022821
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGGCTGTTGTGAACTTGTACCAAGAGGTGATGAAGCACGCAGATCCCCGGATCCAGGGCTACCCTC
TGATGGGGTCCCCCTTGCTAATGACCTCCATTCTCCTGACCTACGTGTACTTCGTTCTCTCACTTGGGCC
TCGCATCATGGCTAATCGGAAGCCCTTCCAGCTCCGTGGCTTCATGATTGTCTACAACTTCTCACTGGTG
GCACTCTCCCTCTACATTGTCTATGAGTTCCTGATGTCGGGCTGGCTGAGCACCTATACCTGGCGCTGTG
ACCCTGTGGACTATTCCAACAGCCCTGAGGCACTTAGGATGGTTCGGGTGGCCTGGCTCTTCCTCTTCTC
CAAGTTCATTGAGCTGATGGACACAGTGATCTTTATTCTCCGAAAGAAAGACGGGCAGGTGACCTTCCTA
CATGTCTTCCATCACTCTGTGCTTCCCTGGAGCTGGTGGTGGGGGGTAAAGATTGCCCCGGGAGGAATGG
GCTCTTTCCATGCCATGATAAACTCTTCCGTGCATGTCATAATGTACCTGTACTACGGATTATCTGCCTT
TGGCCCTGTGGCACAACCCTACCTTTGGTGGAAAAAGCACATGACAGCCATTCAGCTGATCCAGTTTGTC
CTGGTCTCACTGCACATCTCCCAGTACTACTTTATGTCCAGCTGTAACTACCAGTACCCAGTCATTATTC
ACCTCATCTGGATGTATGGCACCATCTTCTTCATGCTGTTCTCCAACTTCTGGTATCACTCTTATACCAA
GGGCAAGCGGCTGCCCCGTGCACTTCAGCAAAATGGAGCTCCAGGTATTGCCAAGGTCAAGGCCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200027 representing NM_022821
Red=Cloning site Green=Tags(s)

MEAVVNLYQEVMKHADPRIQGYPLMGSPLLMTSILLTYVYFVLSLGPRIMANRKPFQLRGFMIVYNFSLV
ALSLYIVYEFLMSGWLSTYTWRCDPVDYSNSPEALRMVRVAWLFLFSKFIELMDTVIFILRKKDGQVTFL
HVFHHSVLPWSWWWGVKIAPGGMGSFHAMINSSVHVIMYLYYGLSAFGPVAQPYLWWKKHMTAIQLIQFV
LVSLHISQYYFMSSCNYQYPVIIHLIWMYGTIFFMLFSNFWYHSYTKGKRLPRALQQNGAPGIAKVKAN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022821
ORF Size 837 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022821.1, NM_022821.2, NM_022821.3, NP_073732
RefSeq Size 1501
Locus ID 64834
Cytogenetics 1p34.2
Domains ELO
Protein Families Transmembrane
MW 32.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.