VPS28 (NM_016208) Human Tagged ORF Clone

CAT#: RC200025

Reviews ()
Write a review

VPS28 (Myc-DDK-tagged)-Human vacuolar protein sorting 28 homolog (S. cerevisiae) (VPS28), transcript variant 1



  "NM_016208" in other vectors (6)

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 118.00

USD 429.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol VPS28
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200025 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTCATGGGATCCCAGCCACGCCGGGCATAGGAGCCCCTGGGAACAAGCCGGAGCTGTATGAGGAAG
TGAAGTTGTACAAGAACGCCCGGGAGAGGGAGAAGTACGACAACATGGCAGAGCTGTTTGCGGTGGTGAA
GACAATGCAAGCCCTGGAGAAGGCCTACATCAAGGACTGTGTCTCCCCCAGCGAGTACACTGCAGCCTGC
TCCCGGCTCCTGGTCCAATACAAAGCTGCCTTCAGGCAGGTCCAGGGCTCAGAAATCAGCTCTATTGACG
AATTCTGCCGCAAGTTCCGCCTGGACTGCCCGCTGGCCATGGAGCGGATCAAGGAGGACCGGCCCATCAC
CATCAAGGACGACAAGGGCAACCTCAACCGCTGCATCGCAGACGTGGTCTCGCTCTTCATCACGGTCATG
GACAAGCTGCGCCTGGAGATCCGCGCCATGGATGAGATCCAGCCCGACCTGCGAGAGCTGATGGAGACCA
TGCACCGCATGAGCCACCTCCCACCCGACTTTGAGGGCCGCCAGACGGTCAGCCAGTGGCTGCAGACCCT
GAGCGGCATGTCGGCGTCAGATGAGCTGGACGACTCACAGGTGCGTCAGATGCTGTTCGACCTGGAGTCA
GCCTACAACGCCTTCAACCGCTTCCTGCATGCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200025 protein sequence
Red=Cloning site Green=Tags(s)

MFHGIPATPGIGAPGNKPELYEEVKLYKNAREREKYDNMAELFAVVKTMQALEKAYIKDCVSPSEYTAAC
SRLLVQYKAAFRQVQGSEISSIDEFCRKFRLDCPLAMERIKEDRPITIKDDKGNLNRCIADVVSLFITVM
DKLRLEIRAMDEIQPDLRELMETMHRMSHLPPDFEGRQTVSQWLQTLSGMSASDELDDSQVRQMLFDLES
AYNAFNRFLHA

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_016208
ORF Size 663 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_016208.2, NP_057292.1
RefSeq Size 994 bp
RefSeq ORF 666 bp
Locus ID 51160
UniProt ID Q9UK41
Cytogenetics 8q24.3
Domains VPS28
Protein Pathways Endocytosis
MW 25.4 kDa
Gene Summary This gene encodes a protein subunit of the ESCRT-I complex (endosomal complexes required for transport), which functions in the transport and sorting of proteins into subcellular vesicles. This complex can also be hijacked to facilitate the budding of enveloped viruses from the cell membrane. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2013]

Other Versions

Other products for "VPS28"
Frequently bought together (5)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


VPS28 mouse monoclonal antibody, clone OTI1A8 (formerly 1A8)
    • 100 ul

USD 417.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 55.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.