DHRS7 (NM_016029) Human Tagged ORF Clone

CAT#: RC200017

DHRS7 (Myc-DDK-tagged)-Human dehydrogenase/reductase (SDR family) member 7 (DHRS7)

Change vector?

USD 98.00

USD 560.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name DHRS7 (NM_016029) Human Tagged ORF Clone
Symbol DHRS7
Synonyms CGI-86; retDSR4; retSDR4; SDR34C1
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200017 representing NM_016029
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACTGGGAGCTGCTGCTGTGGCTGCTGGTGCTGTGCGCGCTGCTCCTGCTCTTGGTGCAGCTGCTGC
GCTTCCTGAGGGCTGACGGCGACCTGACGCTACTATGGGCCGAGTGGCAGGGACGACGCCCAGAATGGGA
GCTGACTGATATGGTGGTGTGGGTGACTGGAGCCTCGAGTGGAATTGGTGAGGAGCTGGCTTACCAGTTG
TCTAAACTAGGAGTTTCTCTTGTGCTGTCAGCCAGAAGAGTGCATGAGCTGGAAAGGGTGAAAAGAAGAT
GCCTAGAGAATGGCAATTTAAAAGAAAAAGATATACTTGTTTTGCCCCTTGACCTGACCGACACTGGTTC
CCATGAAGCGGCTACCAAAGCTGTTCTCCAGGAGTTTGGTAGAATCGACATTCTGGTCAACAATGGTGGA
ATGTCCCAGCGTTCTCTGTGCATGGATACCAGCTTGGATGTCTACAGAAAGCTAATAGAGCTTAACTACT
TAGGGACGGTGTCCTTGACAAAATGTGTTCTGCCTCACATGATCGAGAGGAAGCAAGGAAAGATTGTTAC
TGTGAATAGCATCCTGGGTATCATATCTGTACCTCTTTCCATTGGATACTGTGCTAGCAAGCATGCTCTC
CGGGGTTTTTTTAATGGCCTTCGAACAGAACTTGCCACATACCCAGGTATAATAGTTTCTAACATTTGCC
CAGGACCTGTGCAATCAAATATTGTGGAGAATTCCCTAGCTGGAGAAGTCACAAAGACTATAGGCAATAA
TGGAGACCAGTCCCACAAGATGACAACCAGTCGTTGTGTGCGGCTGATGTTAATCAGCATGGCCAATGAT
TTGAAAGAAGTTTGGATCTCAGAACAACCTTTCTTGTTAGTAACATATTTGTGGCAATACATGCCAACCT
GGGCCTGGTGGATAACCAACAAGATGGGGAAGAAAAGGATTGAGAACTTTAAGAGTGGTGTGGATGCAGA
CTCTTCTTATTTTAAAATCTTTAAGACAAAACATGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200017 representing NM_016029
Red=Cloning site Green=Tags(s)

MNWELLLWLLVLCALLLLLVQLLRFLRADGDLTLLWAEWQGRRPEWELTDMVVWVTGASSGIGEELAYQL
SKLGVSLVLSARRVHELERVKRRCLENGNLKEKDILVLPLDLTDTGSHEAATKAVLQEFGRIDILVNNGG
MSQRSLCMDTSLDVYRKLIELNYLGTVSLTKCVLPHMIERKQGKIVTVNSILGIISVPLSIGYCASKHAL
RGFFNGLRTELATYPGIIVSNICPGPVQSNIVENSLAGEVTKTIGNNGDQSHKMTTSRCVRLMLISMAND
LKEVWISEQPFLLVTYLWQYMPTWAWWITNKMGKKRIENFKSGVDADSSYFKIFKTKHD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_016029
ORF Size 1017 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_016029.1, NM_016029.2, NM_016029.3, NP_057113
RefSeq Size 1282
Locus ID 51635
Cytogenetics 14q23.1
Domains adh_short
Protein Families Transmembrane, Druggable Genome
MW 38.1 kDa
Gene Summary This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family, which has over 46,000 members. Members in this family are enzymes that metabolize many different compounds, such as steroid hormones, prostaglandins, retinoids, lipids and xenobiotics. [provided by RefSeq, Apr 2016].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.