14 3 3 eta(YWHAH) (NM_003405) Human Tagged ORF Clone

CAT#: RC200013

YWHAH (Myc-DDK-tagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)

Need custom modification / cloning service?
Get a free quote

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name 14 3 3 eta(YWHAH) (NM_003405) Human Tagged ORF Clone
Symbol YWHAH
Synonyms YWHA1; YWHA1
Vector pCMV6-Entry
Sequence Data
>RC200013 representing NM_003405
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGACCGGGAGCAGCTGCTGCAGCGGGCGCGGCTGGCCGAGCAGGCGGAGCGCTACGACGACATGG
CCTCCGCTATGAAGGCGGTGACAGAGCTGAATGAACCTCTCTCCAATGAAGATCGAAATCTCCTCTCTGT
GGCCTACAAGAATGTGGTTGGTGCCAGGCGATCTTCCTGGAGGGTCATTAGCAGCATTGAGCAGAAAACC
ATGGCTGATGGAAACGAAAAGAAATTGGAGAAAGTTAAAGCTTACCGGGAGAAGATTGAGAAGGAGCTGG
AGACAGTTTGCAATGATGTCCTGTCTCTGCTTGACAAGTTCCTGATCAAGAACTGCAATGATTTCCAGTA
TGAGAGCAAGGTGTTTTACCTGAAAATGAAGGGTGATTACTACCGCTACTTAGCAGAGGTCGCTTCTGGG
GAGAAGAAAAACAGTGTGGTCGAAGCTTCTGAAGCTGCCTACAAGGAAGCCTTTGAAATCAGCAAAGAGC
AGATGCAACCCACGCATCCCATCCGGCTGGGCCTGGCCCTCAACTTCTCCGTGTTCTACTATGAGATCCA
GAATGCACCTGAGCAAGCCTGCCTCTTAGCCAAACAAGCCTTCGATGATGCCATAGCTGAGCTGGACACA
CTAAACGAGGATTCCTATAAGGACTCCACGCTGATCATGCAGTTGCTGCGAGACAACCTCACCCTCTGGA
CGAGCGACCAGCAGGATGAAGAAGCAGGAGAAGGCAAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>RC200013 representing NM_003405
Red=Cloning site Green=Tags(s)

MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSWRVISSIEQKT
MADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKVFYLKMKGDYYRYLAEVASG
EKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFSVFYYEIQNAPEQACLLAKQAFDDAIAELDT
LNEDSYKDSTLIMQLLRDNLTLWTSDQQDEEAGEGN

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_003405
ORF Size 738 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_003405.1, NM_003405.2, NM_003405.3, NP_003396
RefSeq Size 1807
RefSeq ORF 741
Locus ID 7533
Cytogenetics 22q12.3
Domains 14-3-3
Protein Families Transcription Factors, Druggable Genome
Protein Pathways Cell cycle, Oocyte meiosis, Neurotrophin signaling pathway
MW 28 kDa
Gene Summary This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and bovine orthologs. This gene contains a 7 bp repeat sequence in its 5' UTR, and changes in the number of this repeat have been associated with early-onset schizophrenia and psychotic bipolar disorder. [provided by RefSeq, Jun 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.