SNRNP25 (NM_024571) Human Tagged ORF Clone

CAT#: RC200010

SNRNP25 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25)

Product Images

Circular map for RC200010

• 

  Western blot validation of overexpression lysate (Cat# LY411237) using anti-DDK antibody (Cat# TA50011-100). Left: Cell lysates from un-transfected HEK293T cells; Right: Cell lysates from HEK293T cells transfected with RC200010 using transfection reagent MegaTran 2.0 (Cat# TT210002).

• 

  Coomassie blue staining of purified SNRNP25 protein (Cat# TP300010). The protein was produced from HEK293T cells transfected with SNRNP25 cDNA clone (Cat# RC200010) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Type: Human Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: SNRNP25
• Synonyms: C16orf33
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >RC200010 representing NM_024571.
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
  GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
  ATGGACGTGTTCCAGGAGGGTCTGGCTATGGTGGTGCAGGACCCGCTGCTCTGCGATCTGCCGATCCAG
  GTTACTCTGGAAGAAGTCAACTCCCAAATAGCCCTAGAATACGGCCAGGCAATGACGGTCCGAGTGTGC
  AAGATGGATGGAGAAGTAATGCCCGTGGTTGTAGTGCAGAGTGCCACAGTCCTGGACCTGAAGAAGGCC
  ATCCAGAGATACGTGCAGCTCAAGCAGGAGCGTGAAGGGGGCATTCAGCACATCAGCTGGTCCTACGTG
  TGGAGGACGTACCATCTGACCTCTGCAGGAGAGAAACTCACGGAAGACAGAAAGAAGCTCCGAGACTAC
  GGCATCCGGAATCGAGACGAGGTTTCCTTCATCAAAAAGCTGAGGCAAAAG
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
  TACAAGGATGACGACGATAAGGTTTAAACGGCCGGC
  
  Protein Sequence

  >Peptide sequence encoded by RC200010
  Blue=ORF Red=Cloning site Green=Tag(s)
  
  MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKA
  IQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK
  myc-FLAG tag
  
  Recombinant protein using RC200010 also available, TP300010
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_024571
• ORF Size: 396 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_024571.3
• RefSeq Size: 1103 bp
• RefSeq ORF: 372 bp
• Locus ID: 79622
• UniProt ID: Q9BV90
• Cytogenetics: 16p13.3
• Protein Families: Druggable Genome
• MW: 15.3 kDa
• Gene Summary: Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010]