SNRNP25 (NM_024571) Human Tagged ORF Clone

CAT#: RC200010

SNRNP25 (Myc-DDK-tagged)-Human small nuclear ribonucleoprotein 25kDa (U11/U12) (SNRNP25)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro

AAV Particle: DDK


  "NM_024571" in other vectors (4)

Reconstitution Protocol

Special Offer: 20% off this product. Use code: "Clone20".

USD 150.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


SNRNP25 rabbit polyclonal antibody
    • 100 ul

USD 380.00

Other products for "SNRNP25"

Specifications

Product Data
Type Human Tagged ORF Clone
Tag Myc-DDK
Symbol SNRNP25
Synonyms C16orf33
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>RC200010 representing NM_024571.
Blue=ORF Red=Cloning site Green=Tag(s)

GCTCGTTTAGTGAACCGTCAGAATTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTG
GATCCGGTACCGAGGAGATCTGCCGCCGCGATCGCC
ATGGACGTGTTCCAGGAGGGTCTGGCTATGGTGGTGCAGGACCCGCTGCTCTGCGATCTGCCGATCCAG
GTTACTCTGGAAGAAGTCAACTCCCAAATAGCCCTAGAATACGGCCAGGCAATGACGGTCCGAGTGTGC
AAGATGGATGGAGAAGTAATGCCCGTGGTTGTAGTGCAGAGTGCCACAGTCCTGGACCTGAAGAAGGCC
ATCCAGAGATACGTGCAGCTCAAGCAGGAGCGTGAAGGGGGCATTCAGCACATCAGCTGGTCCTACGTG
TGGAGGACGTACCATCTGACCTCTGCAGGAGAGAAACTCACGGAAGACAGAAAGAAGCTCCGAGACTAC
GGCATCCGGAATCGAGACGAGGTTTCCTTCATCAAAAAGCTGAGGCAAAAG

ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGAT
TACAAGGATGACGACGATAAG
GTTTAAACGGCCGGC
>Peptide sequence encoded by RC200010
Blue=ORF Red=Cloning site Green=Tag(s)

MDVFQEGLAMVVQDPLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDGEVMPVVVVQSATVLDLKKA
IQRYVQLKQEREGGIQHISWSYVWRTYHLTSAGEKLTEDRKKLRDYGIRNRDEVSFIKKLRQK

myc-FLAG tag

Recombinant protein using RC200010 also available, TP300010
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_024571
ORF Size 396 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_024571.3
RefSeq Size 1103 bp
RefSeq ORF 372 bp
Locus ID 79622
UniProt ID Q9BV90
Cytogenetics 16p13.3
Protein Families Druggable Genome
MW 15.3 kDa
Gene Summary Two types of spliceosomes catalyze splicing of pre-mRNAs. The major U2-type spliceosome is found in all eukaryotes and removes U2-type introns, which represent more than 99% of pre-mRNA introns. The minor U12-type spliceosome is found in some eukaryotes and removes U12-type introns, which are rare and have distinct splice consensus signals. The U12-type spliceosome consists of several small nuclear RNAs and associated proteins. This gene encodes a 25K protein that is a component of the U12-type spliceosome. [provided by RefSeq, Apr 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.