TEX264 (NM_015926) Human Tagged ORF Clone

CAT#: RC200008

TEX264 (Myc-DDK-tagged)-Human testis expressed 264 (TEX264), transcript variant 1

Change vector?

USD 98

USD 470


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name TEX264 (NM_015926) Human Tagged ORF Clone
Symbol TEX264
Synonyms ZSIG11
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200008 representing NM_015926
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGACCTGCTACTACTGGGCCTGATTGGGGGCCTGACTCTCTTACTGCTGCTGACGCTGCTGGCCT
TTGCCGGGTACTCAGGGCTACTGGCTGGGGTGGAAGTGAGTGCTGGGTCACCCCCCATCCGCAACGTCAC
TGTGGCCTACAAGTTCCACATGGGGCTCTATGGTGAGACTGGGCGGCTTTTCACTGAGAGCTGCAGCATC
TCTCCCAAGCTCCGCTCCATCGCTGTCTACTATGACAACCCCCACATGGTGCCCCCTGATAAGTGCCGAT
GTGCCGTGGGCAGCATCCTGAGTGAAGGTGAGGAATCGCCCTCCCCTGAGCTCATCGACCTCTACCAGAA
ATTTGGCTTCAAGGTGTTCTCCTTCCCGGCACCCAGCCATGTGGTGACAGCCACCTTCCCCTACACCACC
ATTCTGTCCATCTGGCTGGCTACCCGCCGTGTCCATCCTGCCTTGGACACCTACATCAAGGAGCGGAAGC
TGTGTGCCTATCCTCGGCTGGAGATCTACCAGGAAGACCAGATCCATTTCATGTGCCCACTGGCACGGCA
GGGAGACTTCTATGTGCCTGAGATGAAGGAGACAGAGTGGAAATGGCGGGGGCTTGTGGAGGCCATTGAC
ACCCAGGTGGATGGCACAGGAGCTGACACAATGAGTGACACGAGTTCTGTAAGCTTGGAAGTGAGCCCTG
GCAGCCGGGAGACTTCAGCTGCCACACTGTCACCTGGGGCGAGCAGCCGTGGCTGGGATGACGGTGACAC
CCGCAGCGAGCACAGCTACAGCGAGTCAGGTGCCAGCGGCTCCTCTTTTGAGGAGCTGGACTTGGAGGGC
GAGGGGCCCTTAGGGGAGTCACGGCTGGACCCTGGGACTGAGCCCCTGGGGACTACCAAGTGGCTCTGGG
AGCCCACTGCCCCTGAGAAGGGCAAGGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200008 representing NM_015926
Red=Cloning site Green=Tags(s)

MSDLLLLGLIGGLTLLLLLTLLAFAGYSGLLAGVEVSAGSPPIRNVTVAYKFHMGLYGETGRLFTESCSI
SPKLRSIAVYYDNPHMVPPDKCRCAVGSILSEGEESPSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTT
ILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPLARQGDFYVPEMKETEWKWRGLVEAID
TQVDGTGADTMSDTSSVSLEVSPGSRETSAATLSPGASSRGWDDGDTRSEHSYSESGASGSSFEELDLEG
EGPLGESRLDPGTEPLGTTKWLWEPTAPEKGKE

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_015926
ORF Size 939 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_015926.1, NM_015926.2, NM_015926.3, NM_015926.4, NM_015926.5, NP_057010
RefSeq Size 1601
RefSeq ORF 942
Locus ID 51368
Cytogenetics 3p21.2
Protein Families Secreted Protein, Transmembrane
MW 34.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.