Cyclin G(CCNG1) (NM_199246) Human Tagged ORF Clone

CAT#: RC200001

CCNG1 (Myc-DDK-tagged)-Human cyclin G1 (CCNG1), transcript variant 2

Change vector?

USD 98.00

USD 470.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cyclin G(CCNG1) (NM_199246) Human Tagged ORF Clone
Symbol CCNG1
Synonyms CCNG
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>RC200001 representing NM_199246
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATAGAGGTACTGACAACAACTGACTCTCAGAAACTGCTACACCAGCTGAATGCCCTGTTGGAACAGG
AGTCTAGATGTCAGCCAAAGGTCTGTGGTTTGAGACTAATTGAGTCTGCACACGATAATGGCCTCAGAAT
GACTGCAAGACTAAGGGACTTTGAAGTAAAAGATCTTCTTAGTCTAACTCAGTTCTTTGGCTTTGACACA
GAGACATTTTCTCTAGCTGTGAATTTACTGGACAGATTCCTGTCTAAAATGAAGGTACAGCCCAAGCACC
TTGGGTGTGTTGGACTGAGCTGCTTTTATTTGGCTGTAAAATCAATAGAAGAGGAAAGGAATGTCCCATT
GGCAACTGACTTGATCCGAATAAGTCAATATAGGTTTACGGTTTCAGACTTGATGAGAATGGAAAAGATT
GTATTGGAGAAGGTGTGTTGGAAAGTCAAAGCTACTACTGCCTTTCAATTTCTGCAACTGTATTATTCAC
TCCTTCAAGAGAACTTGCCACTTGAAAGGAGAAATAGCATTAATTTTGAAAGACTAGAAGCTCAACTGAA
GGCATGTCATTGCAGGATCATATTTTCTAAAGCAAAGCCTTCTGTGTTGGCATTGTCTATCATTGCATTA
GAGATCCAAGCACAGAAGTGTGTAGAGTTAACAGAAGGAATAGAATGTCTTCAGAAACATTCCAAGATAA
ATGGCAGAGATCTGACCTTCTGGCAAGAGCTTGTATCCAAATGTTTAACTGAATATTCATCAAATAAGTG
TTCCAAACCAAATGTTCAGAAGTTGAAATGGATTGTTTCTGGGCGTACTGCACGGCAATTGAAGCATAGC
TACTACAGAATAACTCACCTTCCAACAATTCCTGAAATGGTCCCT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>RC200001 representing NM_199246
Red=Cloning site Green=Tags(s)

MIEVLTTTDSQKLLHQLNALLEQESRCQPKVCGLRLIESAHDNGLRMTARLRDFEVKDLLSLTQFFGFDT
ETFSLAVNLLDRFLSKMKVQPKHLGCVGLSCFYLAVKSIEEERNVPLATDLIRISQYRFTVSDLMRMEKI
VLEKVCWKVKATTAFQFLQLYYSLLQENLPLERRNSINFERLEAQLKACHCRIIFSKAKPSVLALSIIAL
EIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHS
YYRITHLPTIPEMVP

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_199246
ORF Size 885 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_199246.1, NP_954854
RefSeq Size 2384
Locus ID 900
Cytogenetics 5q34
Protein Families Druggable Genome
Protein Pathways p53 signaling pathway
MW 33.9 kDa
Gene Summary The eukaryotic cell cycle is governed by cyclin-dependent protein kinases (CDKs) whose activities are regulated by cyclins and CDK inhibitors. The protein encoded by this gene is a member of the cyclin family and contains the cyclin box. The encoded protein lacks the protein destabilizing (PEST) sequence that is present in other family members. Transcriptional activation of this gene can be induced by tumor protein p53. Two transcript variants encoding the same protein have been identified for this gene. [provided by RefSeq, Jul 2008]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.