Sox17 (NM_001289464) Mouse Tagged ORF Clone

CAT#: MR229814

Reviews ()
Write a review
  • TrueORF®

Sox17 (myc-DDK-tagged) - Mouse SRY (sex determining region Y)-box 17 (Sox17), transcript variant 2



Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

2 Weeks*

Size
    • 10 ug

Product images

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Other products for "Sox17"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sox17
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229814 representing NM_001289464
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGCCCGGATGCGGGATACGCCAGTGACGACCAGAGCCAGCCCCGGAGCGCGCAGCCCGCGGTGA
TGGCAGGGTTGGGCCCCTGTCCCTGGGCCGAGTCCCTGAGCCCCCTCGGGGATGTAAAGGTGAAAGGCGA
GGTGGTGGCGAGTAGCGGGGCGCCAGCCGGGACGTCGGGCCGAGCCAAAGCGGAGTCTCGCATCCGGCGG
CCGATGAACGCCTTTATGGTGTGGGCCAAAGACGAACGCAAGCGGTTGGCACAGCAGAACCCAGATCTGC
ACAACGCAGAGCTAAGCAAGATGCTAGGCAAGTCTTGGAAGGCGTTGACCTTGGCAGAGAAGCGGCCCTT
CGTGGAAGAGGCCGAGCGGCTGCGCGTGCAGCATATGCAGGACCACCCCAACTACAAGTACCGGCCGCGG
CGGCGCAAGCAGGTGAAGCGCATGAAGCGGGTGGAGGGAGGCTTCCTGCACGCTCTCGTCGAGCCCCAGG
CCGGCGCGCTTGGTCCCGAGGGCGGCCGCGTGGCCATGGATGGCCTGGGTCTGCCTTTCCCGGAGCCGGG
CTATCCGGCCGGTCCTCCGCTGATGTCTCCGCACATGGGCCCCCACTATCGGGACTGCCAGGGACTGGGC
GCTCCCGCGCTCGACGGCTACCCTCTGCCCACTCCGGACACATCCCCGCTGGATGGCGTGGAGCAGGACC
CGGCTTTCTTTGCAGCCCCGCTGCCAGGGGACTGCCCGGCGGCCGGCACCTACACTTACGCTCCAGTCTC
GGACTATGCAGTGTCCGTAGAGCCGCCCGCTGGCCCCATGCGAGTGGGGCCGGACCCCTCGGGCCCTGCG
ATGCCGGGGATCCTGGCGCCCCCCAGCGCTCTGCACCTGTACTACGGCGCGATGGGCTCGCCCGCCGCAA
GTGCGGGGCGCGGTTTCCACGCGCAACCCCAGCAGCCGCTGCAACCGCAGGCACCGCCGCCGCCACCGCA
GCAGCAGCACCCAGCGCACGGCCCCGGGCAACCTTCGCCCCCTCCCGAGGCTCTGCCCTGCCGGGATGGC
ACGGAATCCAACCAGCCCACTGAGCTCCTAGGGGAGGTGGACCGCACGGAATTCGAACAGTATCTGCCCT
TTGTGTATAAGCCCGAGATGGGTCTTCCCTACCAGGGACACGACTGCGGAGTGAACCTCTCAGACAGCCA
CGGAGCCATTTCCTCCGTGGTGTCCGACGCTAGCTCAGCGGTCTACTATTGCAACTACCCCGACATT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229814 representing NM_001289464
Red=Cloning site Green=Tags(s)

MSSPDAGYASDDQSQPRSAQPAVMAGLGPCPWAESLSPLGDVKVKGEVVASSGAPAGTSGRAKAESRIRR
PMNAFMVWAKDERKRLAQQNPDLHNAELSKMLGKSWKALTLAEKRPFVEEAERLRVQHMQDHPNYKYRPR
RRKQVKRMKRVEGGFLHALVEPQAGALGPEGGRVAMDGLGLPFPEPGYPAGPPLMSPHMGPHYRDCQGLG
APALDGYPLPTPDTSPLDGVEQDPAFFAAPLPGDCPAAGTYTYAPVSDYAVSVEPPAGPMRVGPDPSGPA
MPGILAPPSALHLYYGAMGSPAASAGRGFHAQPQQPLQPQAPPPPPQQQHPAHGPGQPSPPPEALPCRDG
TESNQPTELLGEVDRTEFEQYLPFVYKPEMGLPYQGHDCGVNLSDSHGAISSVVSDASSAVYYCNYPDI

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001289464
ORF Size 1257 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001289464.1, NP_001276393.1
RefSeq Size 3288 bp
RefSeq ORF 1260 bp
Locus ID 20671
UniProt ID Q61473
Cytogenetics 1 1.65 cM
MW 45.1 kDa
Gene Summary This gene encodes a member of the Sox (Sry-related high mobility group box) family of transcription factors involved in the regulation of embryonic development. The encoded protein plays a role in the determination of cell fate and in maintaining cell identity. This gene regulates tumor angiogenesis and tumor progression. Mutations in the human gene are associated with vesicoureteral reflux, characterized by the backward flow of urine from the bladder into the ureters or the kidney. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.