Ager (NM_001271423) Mouse Tagged ORF Clone

CAT#: MR229634

  • TrueORF®

Ager (myc-DDK-tagged) - Mouse advanced glycosylation end product-specific receptor (Ager), transcript variant 3


  "NM_001271423" in other vectors (1)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 503.00

2 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Ager"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ager
Synonyms RAGE
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR229634 representing NM_001271423
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCAGCGGGGACAGCAGCTAGAGCCTGGGTGCTGGTTCTTGCTCTATGGGGAGCTGTAGCTGGTGGTC
AGAACATCACAGCCCGGATTGGAGAGCCACTTGTGCTAAGCTGTAAGGGGGCCCCTAAGAAGCCGCCCCA
GCAGCTAGAATGGAAACTGGTCCTCTCTCCCCAGGGAGGCCCCTGGGACAGCGTGGCTCGAATCCTCCCC
AATGGTTCCCTCCTCCTTCCAGCCACTGGAATTGTCGATGAGGGGACTTTCCGGTGTCGGGCAACTAACA
GGCGAGGGAAGGAGGTCAAGTCCAACTACCGAGTCCGAGTCTACCAGATTCCTGGGAAGCCAGAAATTGT
GGATCCTGCCTCTGAACTCACAGCCAGTGTCCCTAATAAGGTGGGGACATGTGTGTCTGAGGGAAGCTAC
CCTGCAGGGACCCTTAGCTGGCACTTAGATGGGAAACTTCTGATTCCCGATGGCAAAGAAACACTCGTGA
AGGAAGAGACCAGGAGACACCCTGAGACGGGACTCTTTACACTGCGGTCAGAGCTGACAGTGATCCCCAC
CCAAGGAGGAACCCATCCTACCTTCTCCTGCAGTTTCAGCCTGGGCCTTCCCCGGCGCAGACCCCTGAAC
ACAGCCCCCATCCAACTCCGAGTCAGGGAGCCTGGGCCTCCAGAGGGCATTCAGCTGTTGGTTGAGCCTG
AAGGTGGAATAGTCGCTCCTGGTGGGACTGTGACCTTGACCTGTGCCATCTCTGCCCAGCCCCCTCCTCA
GGTCCACTGGATAAAGGATGGTGCACCCTTGCCCCTGGCTCCCAGCCCTGTGCTGCTCCTCCCTGAGGTG
GGGCACGAGGATGAGGGCACCTATAGCTGCGTGGCCACCCACCCTAGCCACGGACCTCAGGAAAGCCCTC
CTGTCAGCATCAGGGTCACAGGCTCTGTGGGTGAGTCTGGGCTGGGTACGCTAGCCCTGGCCTTGGGGAT
CCTGGGAGGCCTGGGAGTAGTAGCCCTGCTCGTCGGGGCTATCCTGTGGCGAAAACGACAACCCAGGCGT
GAGGAGAGGAAGGCCCCGGAAAGCCAGGAGGATGAGGAGGAACGTGCAGAGCTGAATCAGTCAGAGGAAG
CGGAGATGCCAGAGAATGGTGCCGGGGGACCG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR229634 representing NM_001271423
Red=Cloning site Green=Tags(s)

MPAGTAARAWVLVLALWGAVAGGQNITARIGEPLVLSCKGAPKKPPQQLEWKLVLSPQGGPWDSVARILP
NGSLLLPATGIVDEGTFRCRATNRRGKEVKSNYRVRVYQIPGKPEIVDPASELTASVPNKVGTCVSEGSY
PAGTLSWHLDGKLLIPDGKETLVKEETRRHPETGLFTLRSELTVIPTQGGTHPTFSCSFSLGLPRRRPLN
TAPIQLRVREPGPPEGIQLLVEPEGGIVAPGGTVTLTCAISAQPPPQVHWIKDGAPLPLAPSPVLLLPEV
GHEDEGTYSCVATHPSHGPQESPPVSIRVTGSVGESGLGTLALALGILGGLGVVALLVGAILWRKRQPRR
EERKAPESQEDEEERAELNQSEEAEMPENGAGGP

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001271423
ORF Size 1152 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001271423.1, NP_001258352.1
RefSeq Size 1333 bp
RefSeq ORF 1155 bp
Locus ID 11596
UniProt ID Q62151
Cytogenetics 17 B1
MW 41.2 kDa
Gene Summary Mediates interactions of advanced glycosylation end products (AGE). These are nonenzymatically glycosylated proteins which accumulate in vascular tissue in aging and at an accelerated rate in diabetes. Acts as a mediator of both acute and chronic vascular inflammation in conditions such as atherosclerosis and in particular as a complication of diabetes. AGE/RAGE signaling plays an important role in regulating the production/expression of TNF-alpha, oxidative stress, and endothelial dysfunction in type 2 diabetes. Interaction with S100A12 on endothelium, mononuclear phagocytes, and lymphocytes triggers cellular activation, with generation of key proinflammatory mediators. Interaction with S100B after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Can also bind oligonucleotides. Receptor for amyloid beta peptide. Contributes to the translocation of amyloid-beta peptide (ABPP) across the cell membrane from the extracellular to the intracellular space in cortical neurons. ABPP-initiated RAGE signaling, especially stimulation of p38 mitogen-activated protein kinase (MAPK), has the capacity to drive a transport system delivering ABPP as a complex with RAGE to the intraneuronal space. RAGE-dependent signaling in microglia contributes to neuroinflammation, amyloid accumulation, and impaired learning/memory in a mouse model of Alzheimer disease.[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.