Rgr (NM_001301694) Mouse Tagged ORF Clone

CAT#: MR228343

Reviews ()
Write a review
  • TrueORF®

Rgr (myc-DDK-tagged) - Mouse retinal G protein coupled receptor (Rgr), transcript variant 3

  View "NM_001301694" in other vectors (1)

Interest in protein/lysate? Sumbit request here!

USD 330.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Rgr (NM_001301694) Mouse Tagged ORF Clone
Symbol Rgr
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR228343 representing NM_001301694
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCCTTGTTGCAGCGGTATCCAGCCTCCTCCGGCAGACAGTTGGCATGGGACACGGCCATCCCTCTGG
TGCTGTTTGTGTGGATGTCATCTGCCTTCTGGGCATCCCTGCCCCTGATGGGCTGGGGCCACTATGACTA
TGAGCCTGTGGGGACATGCTGTACACTGGACTATTCGAGGGGTGACAGAAACTTCATCAGTTTTCTCTTC
ACCATGGCTTTTTTCAACTTCCTCGTACCCCTGTTCATCACACACACTTCATACCGGTTCATGGAGCAGA
AATTCTCCAGGAGTGGCCATCTCCCGGTGAATACTACTCTTCCAGGCAGAATGCTGCTGCTTGGCTGGGG
CCCCTATGCCCTCCTGTACCTATACGCAGCCATCGCAGATGTGAGCTTCATCTCTCCTAAACTACAGATG
GTGCCTGCTCTCATCGCCAAAACCATGCCCACAATCAACGCCATCAACTATGCGTTGCACAGGGAGATGG
TCTGTAGAGGAACCTGGCAGTGTCTGTCTCCACAAAAAAGCAAGAAGGACCGAACCCAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR228343 representing NM_001301694
Red=Cloning site Green=Tags(s)

MPLLQRYPASSGRQLAWDTAIPLVLFVWMSSAFWASLPLMGWGHYDYEPVGTCCTLDYSRGDRNFISFLF
TMAFFNFLVPLFITHTSYRFMEQKFSRSGHLPVNTTLPGRMLLLGWGPYALLYLYAAIADVSFISPKLQM
VPALIAKTMPTINAINYALHREMVCRGTWQCLSPQKSKKDRTQ

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001301694
ORF Size 549 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001301694.1, NP_001288623
RefSeq Size 4135
RefSeq ORF 552
Locus ID 57811
Cytogenetics 14 B
MW 21.4 kDa
Gene Summary The gene is a member of the opsin family of G-protein coupled receptors. The encoded protein is expressed in the retina, and acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. Disruption of a similar gene in human is associated with autosomal recessive (arRP) and autosomal dominant retinitis pigmentosa (adRP). Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2014]

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
40% off proteins and antibodies
68 Mouse Clones