Sh3kbp1 (NM_001290664) Mouse Tagged ORF Clone

CAT#: MR227895

Sh3kbp1 (myc-DDK-tagged) - Mouse SH3-domain kinase binding protein 1 (Sh3kbp1), transcript variant 5

Product Images

Circular map for MR227895

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Sh3kbp1
• Synonyms: 1200007H22Rik; 1700125L08Rik; 5830464D22Rik; AI447724; Cin85; IN85; Ruk; Seta
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR227895 representing NM_001290664
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGGCAGCTGCCAGCAGTGGGCCAGCTTCTCTCTCTTCAGTGGCATCCTCACCCATGTCATCCTCTTTGG
  GAACAGCTGGACAGAGAGCCAGTTCTCCATCTCTGTTCAGCACAGAAGGAAAGCCAAAGATGGAGCCAGC
  AGTGAGCAGCCAGGCTGCTATCGAGGAGCTTAAGATGCAAGTCCGTGAGCTGAGGACCATCATTGAGACC
  ATGAAGGACCAGCAGAAACGTGAGATTAAGCAGTTACTGTCAGAATTGGATGAAGAGAAAAAGATCCGGC
  TCCGGTTGCAGATGGAAGTGAACGACATAAAGAAAGCTCTTCAATCAAAG
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR227895 representing NM_001290664
  Red=Cloning site Green=Tags(s)
  
  MAAASSGPASLSSVASSPMSSSLGTAGQRASSPSLFSTEGKPKMEPAVSSQAAIEELKMQVRELRTIIET
  MKDQQKREIKQLLSELDEEKKIRLRLQMEVNDIKKALQSK
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_001290664
• ORF Size: 330 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_001290664.1, NP_001277593.1
• RefSeq Size: 3721 bp
• RefSeq ORF: 333 bp
• Locus ID: 58194
• UniProt ID: Q8R550
• Cytogenetics: X F4
• MW: 12.4 kDa
• Gene Summary: Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through an association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may be inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor. Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration (By similarity).[UniProtKB/Swiss-Prot Function]