Psma6 (NM_011968) Mouse Tagged ORF Clone

CAT#: MR227637

Psma6 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) subunit, alpha type 6 (Psma6)

Product Images

Circular map for MR227637

Specifications

Product Data

• Type: Mouse Tagged ORF Clone
• Tag: Myc-DDK
• Symbol: Psma6
• Synonyms: IOTA
• Vector: pCMV6-Entry
• E. coli Selection: Kanamycin (25 ug/mL)
• Mammalian Cell Selection: Neomycin
• Sequence Data:
  ORF Nucleotide Sequence

  >MR227637 representing NM_011968
  Red=Cloning site Blue=ORF Green=Tags(s)
  
  TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
  GCCGCGATCGCC
  
  ATGTCCCGGGGTTCCAGCGCCGGTTTTGACCGTCACATTACTATCTTCTCTCCCGAGGGCCGACTCTACC
  AAGTAGAATATGCTTTTAAGGCTATTAACCAGGGTGGACTTACATCTGTTGCTGTCAGAGGAAAGGACTG
  TGCAGTTATTGTCACACAGAAGAAAGTACCCGACAAACTACTGGATTCCAGCACAGTGACTCACTTGTTC
  AAGATAACGGAAAGCATTGGCTGTGTGATGACAGGAATGACAGCTGACAGCAGATCCCAGGTACAGAGGG
  CACGCTATGAGGCAGCTAATTGGAAATACAAGTATGGCTATGAAATTCCTGTGGACATGCTGTGCAAAAG
  AATTGCTGATATTTCTCAAGTCTACACACAGAACGCTGAAATGAGGCCACTCGGTTGTTGTATGATTTTA
  ATCGGTATCGATGAAGAGCAAGGCCCTCAAGTGTACAAGTGTGATCCTGCAGGTTACTACTGTGGCTTTA
  AAGCCACGGCGGCAGGAGTTAAACAAACAGAGTCAACCAGCTTCCTTGAAAAGAAAGTGAAGAAGAAATT
  TGATTGGACATTTGAACAGACAGTGGAAACTGCAATTACATGCCTGTCTACTGTTCTGTCGATTGACTTC
  AAACCTTCAGAAATAGAAGTTGGAGTAGTTACAGTTGAAAATCCTAAATTCAGGATTCTTACTGAAGCAG
  AGATTGACGCTCACCTTGTTGCTCTAGCAGAGAGAGAC
  
  ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
  ACAAGGATGACGACGATAAGGTTTAA
  Protein Sequence

  >MR227637 representing NM_011968
  Red=Cloning site Green=Tags(s)
  
  MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLLDSSTVTHLF
  KITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADISQVYTQNAEMRPLGCCMIL
  IGIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITCLSTVLSIDF
  KPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD
  
  myc-FLAG tag
• Restriction Sites: SgfI-MluI Cloning Scheme for this gene Plasmid Map
• ACCN: NM_011968
• ORF Size: 738 bp
• OTI Disclaimer: The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
• OTI Annotation: This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
• Product Components: The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
• Reconstitution: 1. Centrifuge at 5,000xg for 5min.
  2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
  3. Close the tube and incubate for 10 minutes at room temperature.
  4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
  5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.

Reference Data

• RefSeq: NM_011968.3, NP_036098.1
• RefSeq Size: 997 bp
• RefSeq ORF: 741 bp
• Locus ID: 26443
• UniProt ID: Q9QUM9
• Cytogenetics: 12 C1
• MW: 27.8 kDa
• Gene Summary: Component of the 20S core proteasome complex involved in the proteolytic degradation of most intracellular proteins. This complex plays numerous essential roles within the cell by associating with different regulatory particles. Associated with two 19S regulatory particles, forms the 26S proteasome and thus participates in the ATP-dependent degradation of ubiquitinated proteins. The 26S proteasome plays a key role in the maintenance of protein homeostasis by removing misfolded or damaged proteins that could impair cellular functions, and by removing proteins whose functions are no longer required. Associated with the PA200 or PA28, the 20S proteasome mediates ubiquitin-independent protein degradation. This type of proteolysis is required in several pathways including spermatogenesis (20S-PA200 complex) or generation of a subset of MHC class I-presented antigenic peptides (20S-PA28 complex).[UniProtKB/Swiss-Prot Function]