Tmem173 (NM_028261) Mouse Tagged ORF Clone

CAT#: MR227544

  • TrueORF®

Tmem173 (Myc-DDK-tagged) - Mouse transmembrane protein 173 (Tmem173), nuclear gene encoding mitochondrial protein

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro


  "NM_028261" in other vectors (6)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Get a free Anti-DDK antibody sample free with this product. Use code: "DDK-Clone". View details »

USD 686.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


STING Rabbit polyclonal Antibody
    • 100 ul

USD 313.00

Other products for "Tmem173"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Tmem173
Synonyms 2610307O08Rik; ERIS; Mita; MPYS; STING
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227544 representing NM_028261
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCATACTCCAACCTGCATCCAGCCATCCCACGGCCCAGAGGTCACCGCTCCAAATATGTAGCCCTCA
TCTTTCTGGTGGCCAGCCTGATGATCCTTTGGGTGGCAAAGGATCCACCAAATCACACTCTGAAGTACCT
AGCACTTCACCTAGCCTCGCACGAACTTGGACTACTGTTGAAAAACCTCTGCTGTCTGGCTGAAGAGCTG
TGCCATGTCCAGTCCAGGTACCAGGGCAGCTACTGGAAGGCTGTGCGCGCCTGCCTGGGATGCCCCATCC
ACTGTATGGCTATGATTCTACTATCGTCTTATTTCTATTTCCTCCAAAACACTGCTGACATATACCTCAG
TTGGATGTTTGGCCTTCTGGTCCTCTATAAGTCCCTAAGCATGCTCCTGGGCCTTCAGAGCTTGACTCCA
GCGGAAGTCTCTGCAGTCTGTGAAGAAAAGAAGTTAAATGTTGCCCACGGGCTGGCCTGGTCATACTACA
TTGGGTACTTGCGGTTGATCTTACCAGGGCTCCAGGCCCGGATCCGAATGTTCAATCAGCTACATAACAA
CATGCTCAGTGGTGCAGGGAGCCGAAGACTGTACATCCTCTTTCCATTGGACTGTGGGGTGCCTGACAAC
CTGAGTGTAGTTGACCCCAACATTCGATTCCGAGATATGCTGCCCCAGCAAAACATCGACCGTGCTGGCA
TCAAGAATCGGGTTTATTCCAACAGCGTCTACGAGATTCTGGAGAACGGACAGCCAGCAGGCGTCTGTAT
CCTGGAGTACGCCACCCCCTTGCAGACCCTGTTTGCCATGTCACAGGATGCCAAAGCTGGCTTCAGTCGG
GAGGATCGGCTTGAGCAGGCTAAACTCTTCTGCCGGACACTTGAGGAAATCCTGGAAGATGTCCCCGAGT
CTCGAAATAACTGCCGCCTCATTGTCTACCAAGAACCCACAGACGGAAACAGTTTCTCACTGTCTCAGGA
GGTGCTCCGGCACATTCGTCAGGAAGAAAAGGAGGAGGTTACCATGAATGCCCCCATGACCTCAGTGGCA
CCTCCTCCCTCCGTACTGTCCCAAGAGCCAAGACTCCTCATCAGTGGTATGGATCAGCCTCTCCCACTCC
GCACTGACCTCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227544 representing NM_028261
Red=Cloning site Green=Tags(s)

MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEEL
CHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTP
AEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDN
LSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSR
EDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVA
PPPSVLSQEPRLLISGMDQPLPLRTDLI

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_028261
ORF Size 1134 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_028261.1, NP_082537.1
RefSeq Size 2302 bp
RefSeq ORF 1137 bp
Locus ID 72512
UniProt ID Q3TBT3
Cytogenetics 18
MW 43.3 kDa
Gene Summary Facilitator of innate immune signaling that acts as a sensor of cytosolic DNA from bacteria and viruses and promotes the production of type I interferon (IFN-alpha and IFN-beta) (PubMed:18818105, PubMed:19433799, PubMed:19776740, PubMed:26229117, PubMed:26669264). Innate immune response is triggered in response to non-CpG double-stranded DNA from viruses and bacteria delivered to the cytoplasm (PubMed:18818105, PubMed:19433799, PubMed:19776740, PubMed:26229117, PubMed:26669264). Acts by binding cyclic dinucleotides: recognizes and binds cyclic di-GMP (c-di-GMP), a second messenger produced by bacteria, and cyclic GMP-AMP (cGAMP), a messenger produced by CGAS in response to DNA virus in the cytosol (PubMed:21947006, PubMed:23722158, PubMed:23258412, PubMed:23519410, PubMed:23910378). Upon binding of c-di-GMP or cGAMP, TMEM173/STING oligomerizes, translocates from the endoplasmic reticulum and is phosphorylated by TBK1 on the pLxIS motif, leading to recruitment and subsequent activation of the transcription factor IRF3 to induce expression of type I interferon and exert a potent anti-viral state (PubMed:25636800). In addition to promote the production of type I interferons, plays a direct role in autophagy (PubMed:30568238). Following cGAMP-binding, TMEM173/STING buds from the endoplasmic reticulum into COPII vesicles, which then form the endoplasmic reticulum-Golgi intermediate compartment (ERGIC) (By similarity). The ERGIC serves as the membrane source for WIPI2 recruitment and LC3 lipidation, leading to formation of autophagosomes that target cytosolic DNA or DNA viruses for degradation by the lysosome (By similarity). The autophagy- and interferon-inducing activities can be uncoupled and autophagy induction is independent of TBK1 phosphorylation (By similarity). Autophagy is also triggered upon infection by bacteria: following c-di-GMP-binding, which is produced by live Gram-positive bacteria, promotes reticulophagy (PubMed:29056340). Exhibits 2',3' phosphodiester linkage-specific ligand recognition: can bind both 2'-3' linked cGAMP (2'-3'-cGAMP) and 3'-3' linked cGAMP but is preferentially activated by 2'-3' linked cGAMP (PubMed:26300263). The preference for 2'-3'-cGAMP, compared to other linkage isomers is probably due to the ligand itself, whichs adopts an organized free-ligand conformation that resembles the TMEM173/STING-bound conformation and pays low energy costs in changing into the active conformation (By similarity). May be involved in translocon function, the translocon possibly being able to influence the induction of type I interferons (By similarity). May be involved in transduction of apoptotic signals via its association with the major histocompatibility complex class II (MHC-II) (PubMed:18559423).[UniProtKB/Swiss-Prot Function]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.