Abcb1a (NM_011076) Mouse Tagged ORF Clone

CAT#: MR227524

Abcb1a (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family B (MDR/TAP), member 1A (Abcb1a). Note: ORF is codon optimized

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 1,628.00


Availability*
2 Weeks

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Abcb1a (NM_011076) Mouse Tagged ORF Clone
Symbol Abcb1a
Synonyms Abcb4; Evi32; mdr-3; Mdr1a; Mdr3; P-gp; Pgp; Pgy-3; Pgy3
Vector pCMV6-Entry
Sequence Data
>MR227524 representing NM_011076, codon optimized.
Due to the complexity of NM_011076, the ORF clone is codon optimized for mammalian Expression.
The nucleotide sequence differs from the reference sequence, yet the amino acid sequence remains identical
.

Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGAGTTGGAGGAGGACCTCAAGGGCCGAGCGGACAAAAATTTTAGTAAGATGGGCAAGAAATCCAAGA
AAGAGAAGAAGGAAAAAAAGCCAGCCGTGTCTGTGCTCACAATGTTCCGATACGCAGGGTGGCTTGATCG
GCTCTACATGCTCGTCGGAACGTTGGCTGCCATCATCCACGGAGTAGCGCTGCCTTTGATGATGTTGATT
TTCGGTGACATGACCGACTCATTCGCATCCGTTGGGAACGTGTCTAAGAACAGCACAAACATGAGTGAGG
CTGACAAAAGGGCAATGTTCGCAAAGCTTGAAGAGGAGATGACGACCTACGCATACTACTACACAGGTAT
CGGCGCAGGGGTCCTCATCGTGGCCTACATCCAGGTGAGTTTCTGGTGTCTGGCCGCTGGCAGACAAATT
CACAAGATCAGACAAAAATTCTTTCACGCTATTATGAATCAGGAGATTGGATGGTTTGATGTCCACGATG
TCGGAGAGCTGAACACCCGGCTGACCGACGATGTTAGCAAGATTAATGAAGGTATCGGAGACAAGATCGG
CATGTTTTTCCAGGCTATGGCGACCTTCTTCGGCGGTTTTATTATAGGATTCACCCGGGGTTGGAAACTC
ACTCTGGTGATACTTGCTATCAGTCCAGTGCTCGGACTGTCTGCTGGCATATGGGCCAAAATTCTCAGCT
CATTCACTGACAAAGAACTGCACGCATATGCCAAAGCAGGTGCAGTGGCAGAGGAAGTACTCGCTGCCAT
TCGCACCGTCATAGCCTTTGGGGGTCAGAAGAAGGAGCTGGAAAGGTACAACAATAACCTGGAAGAGGCT
AAGAGGCTCGGAATAAAAAAGGCCATTACCGCCAACATCAGCATGGGAGCGGCATTCCTTCTCATCTACG
CCTCTTACGCCCTGGCCTTCTGGTACGGAACTAGCCTGGTCATTTCCAAAGAATACAGCATCGGGCAGGT
GCTTACCGTGTTCTTCTCCGTCCTCATCGGCGCTTTCTCCGTCGGTCAGGCCAGCCCCAATATCGAGGCA
TTCGCTAATGCCAGAGGAGCCGCATATGAAGTATTTAAGATCATTGACAACAAGCCATCCATCGACTCTT
TTTCTAAATCTGGACACAAGCCAGATAACATCCAAGGGAACCTGGAATTTAAAAATATTCACTTCAGTTA
TCCCTCCCGGAAGGAGGTCCAGATCCTTAAAGGACTCAATCTTAAAGTCAAATCCGGCCAGACTGTAGCA
CTCGTCGGTAATTCTGGGTGTGGGAAGAGTACCACAGTGCAGTTGATGCAGCGCCTCTATGACCCCTTGG
ACGGGATGGTCAGCATAGACGGGCAAGATATTAGGACAATCAACGTTCGATATCTGCGAGAAATTATCGG
TGTCGTGAGCCAAGAACCAGTCCTCTTCGCCACTACTATTGCAGAGAACATCAGATATGGCCGAGAGGAT
GTCACAATGGACGAGATTGAGAAGGCTGTCAAAGAGGCTAATGCTTACGATTTCATCATGAAGCTGCCTC
ACCAGTTTGACACACTCGTTGGTGAGAGGGGCGCTCAATTGTCCGGCGGACAGAAGCAAAGGATCGCAAT
TGCGCGGGCGCTCGTGCGCAACCCAAAAATATTGCTGTTGGACGAAGCCACCTCTGCACTGGACACCGAG
TCCGAGGCCGTGGTGCAGGCTGCCCTTGATAAGGCTCGGGAGGGCCGAACCACTATTGTCATTGCACACC
GCCTCTCCACAGTGAGAAACGCCGACGTCATCGCAGGGTTCGATGGCGGCGTCATTGTGGAACAGGGCAA
CCACGATGAACTCATGCGCGAGAAGGGAATATATTTTAAACTGGTGATGACCCAGACCGCGGGCAATGAG
ATCGAACTGGGAAACGAGGCCTGTAAGAGCAAGGATGAAATTGACAACCTGGACATGTCTAGCAAAGACT
CCGGATCTTCTTTGATTAGGAGGCGCTCCACGCGGAAGTCCATTTGTGGACCACATGATCAAGACCGCAA
GCTCTCCACCAAGGAGGCACTGGACGAGGACGTTCCTCCTGCCTCATTCTGGCGGATTCTGAAATTGAAC
AGCACAGAATGGCCATACTTTGTTGTGGGAATCTTTTGCGCTATTATTAACGGGGGGCTCCAACCAGCAT
TCTCCGTCATTTTCTCCAAGGTGGTGGGCGTCTTCACTAATGGTGGACCACCAGAAACTCAAAGACAGAA
TAGTAACTTGTTTTCACTTCTCTTCCTTATACTCGGCATTATTAGCTTTATTACGTTTTTCCTGCAGGGG
TTTACATTTGGCAAGGCTGGAGAGATTCTGACAAAGCGCCTGAGATACATGGTCTTTAAGTCAATGCTTA
GGCAGGACGTCAGCTGGTTCGACGATCCCAAAAATACTACCGGAGCTCTTACCACTCGCCTTGCCAATGA
CGCCGCTCAGGTGAAGGGAGCTACAGGCAGTCGACTTGCTGTAATCTTCCAGAACATCGCTAACTTGGGG
ACTGGAATCATCATATCCTTGATATATGGCTGGCAACTTACATTGCTTCTTCTCGCCATTGTTCCTATTA
TTGCAATCGCTGGAGTCGTTGAGATGAAAATGCTGTCAGGGCAGGCCCTGAAAGACAAAAAGGAATTGGA
GGGTAGTGGCAAAATTGCCACAGAAGCAATTGAAAACTTCAGAACTGTTGTCTCTTTGACGAGAGAACAA
AAATTCGAAACAATGTATGCCCAGTCTTTGCAGATCCCATACAGGAACGCAATGAAAAAGGCCCACGTGT
TCGGTATCACTTTTTCTTTTACACAGGCAATGATGTATTTCTCTTACGCTGCCTGTTTTAGATTCGGCGC
GTATCTTGTGACGCAGCAGCTGATGACTTTCGAGAATGTCCTTCTTGTATTTAGTGCCATCGTGTTTGGG
GCAATGGCGGTCGGGCAGGTAAGCTCCTTCGCCCCTGACTATGCTAAGGCAACGGTGAGCGCTAGCCATA
TCATCAGGATCATAGAGAAGACTCCCGAGATAGATTCCTATTCTACCCAGGGGCTGAAGCCTAACATGCT
GGAAGGCAACGTCCAATTTTCTGGGGTTGTGTTCAATTATCCGACTCGACCCTCCATTCCCGTACTGCAA
GGCCTCTCTCTCGAGGTCAAAAAGGGCCAAACTCTCGCCTTGGTTGGCTCATCTGGATGTGGCAAGAGCA
CTGTTGTGCAATTGCTGGAGCGATTTTATGATCCAATGGCTGGCTCAGTGTTTCTGGACGGCAAGGAGAT
CAAGCAGCTCAACGTGCAGTGGCTGCGCGCCCAGCTTGGGATAGTCAGTCAGGAACCAATCCTGTTTGAC
TGCTCAATAGCTGAGAACATTGCCTACGGGGACAATAGCCGGGTCGTTTCATACGAGGAAATTGTTAGGG
CTGCGAAAGAGGCTAACATTCATCAATTTATCGACTCCCTGCCTGACAAGTATAATACAAGGGTTGGAGA
TAAAGGTACACAGCTGTCAGGTGGTCAGAAGCAGCGGATCGCTATTGCTCGCGCTCTGGTTCGACAGCCA
CACATCTTGCTTTTGGATGAAGCCACCTCAGCATTGGATACCGAGTCCGAGAAAGTCGTGCAGGAGGCTC
TGGATAAGGCTAGAGAAGGAAGGACATGTATCGTAATCGCACATCGGCTTTCCACTATCCAGAACGCAGA
CCTGATAGTGGTCATCCAGAACGGAAAAGTCAAGGAACATGGGACCCACCAGCAGCTTCTTGCTCAGAAG
GGAATTTACTTCTCCATGGTGTCCGTCCAGGCAGGCGCTAAGCGGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227524 representing NM_011076
Red=Cloning site Green=Tags(s)

MELEEDLKGRADKNFSKMGKKSKKEKKEKKPAVSVLTMFRYAGWLDRLYMLVGTLAAIIHGVALPLMMLI
FGDMTDSFASVGNVSKNSTNMSEADKRAMFAKLEEEMTTYAYYYTGIGAGVLIVAYIQVSFWCLAAGRQI
HKIRQKFFHAIMNQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQAMATFFGGFIIGFTRGWKL
TLVILAISPVLGLSAGIWAKILSSFTDKELHAYAKAGAVAEEVLAAIRTVIAFGGQKKELERYNNNLEEA
KRLGIKKAITANISMGAAFLLIYASYALAFWYGTSLVISKEYSIGQVLTVFFSVLIGAFSVGQASPNIEA
FANARGAAYEVFKIIDNKPSIDSFSKSGHKPDNIQGNLEFKNIHFSYPSRKEVQILKGLNLKVKSGQTVA
LVGNSGCGKSTTVQLMQRLYDPLDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFATTIAENIRYGRED
VTMDEIEKAVKEANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTE
SEAVVQAALDKAREGRTTIVIAHRLSTVRNADVIAGFDGGVIVEQGNHDELMREKGIYFKLVMTQTAGNE
IELGNEACKSKDEIDNLDMSSKDSGSSLIRRRSTRKSICGPHDQDRKLSTKEALDEDVPPASFWRILKLN
STEWPYFVVGIFCAIINGGLQPAFSVIFSKVVGVFTNGGPPETQRQNSNLFSLLFLILGIISFITFFLQG
FTFGKAGEILTKRLRYMVFKSMLRQDVSWFDDPKNTTGALTTRLANDAAQVKGATGSRLAVIFQNIANLG
TGIIISLIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEGSGKIATEAIENFRTVVSLTREQ
KFETMYAQSLQIPYRNAMKKAHVFGITFSFTQAMMYFSYAACFRFGAYLVTQQLMTFENVLLVFSAIVFG
AMAVGQVSSFAPDYAKATVSASHIIRIIEKTPEIDSYSTQGLKPNMLEGNVQFSGVVFNYPTRPSIPVLQ
GLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPMAGSVFLDGKEIKQLNVQWLRAQLGIVSQEPILFD
CSIAENIAYGDNSRVVSYEEIVRAAKEANIHQFIDSLPDKYNTRVGDKGTQLSGGQKQRIAIARALVRQP
HILLLDEATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADLIVVIQNGKVKEHGTHQQLLAQK
GIYFSMVSVQAGAKRS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_011076
ORF Size 3828 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_011076.1, NM_011076.2, NP_035206
RefSeq Size 5177
RefSeq ORF 3831
Locus ID 18671
Cytogenetics 5 A1|5 3.43 cM
MW 140.6 kDa
Gene Summary The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a p-glycoprotein which actively transports a variety of hydrophobic amphipathic drugs and plays a major role in the blood-brain barrier permeability of certain drugs. [provided by RefSeq, Jul 2008].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)