Sall4 (NM_175303) Mouse Tagged ORF Clone

CAT#: MR227483

Reviews ()
Write a review
  • TrueORF®

Sall4 (Myc-DDK-tagged) - Mouse sal-like 4 (Drosophila) (Sall4), transcript variant a



  "NM_175303" in other vectors (4)

Interest in protein/lysate? Submit request here!

Reconstitution Protocol

Special Offer: 20% off the control vector (empty cloning vector without insert). Use code "Shuttle20".

USD 1,022.00


Availability*
5 Weeks

Size
    • 10 ug


Product images

Other products for "Sall4"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Sall4
Synonyms 5730441M18Rik; AA407717; AL022809; AW536104; C78083; C78563; C330011P20Rik; Tex20
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR227483 representing NM_175303
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGAGGCGCAAGCAGGCGAAGCCCCAGCACATCAACTGGGAGGAGGGCCAGGGCGAGCAGCCTCAGC
AGCTACCGAGCCCCGACCTCGCCGAGGCGCTGGCGGCGGAGGAACCCGGTGCTCCAGTGAACTCCCCTGG
GAACTGCGATGAAGCCTCAGAGGACTCCATACCGGTGAAGCGGCCCCGGCGGGAGGACACTCACATCTGC
AACAAATGCTGTGCCGAGTTCTTTAGTCTCTCTGAATTCATGGAACACAAGAAAAGTTGCACTAAAACCC
CTCCTGTCCTCATCATGAATGACAGCGAGGGGCCAGTGCCTTCAGAGGACTTTTCCAGAGCTGCCCTGAG
CCACCAGCTGGGCAGCCCAAGCAATAAAGACAGTCTCCAGGAGAACGGCAGCAGCTCGGGGGACTTGAAG
AAGCTGGGCACGGACTCCATCCTGTACTTGAAGACAGAGGCTACCCAGCCATCCACACCCCAGGACATAA
GCTATTTACCCAAAGGCAAAGTAGCCAACACCAATGTGACTCTGCAGGCGCTCCGCGGCACCAAGGTGGC
CGTGAACCAACGGGGTGCAGAGGCACCCATGGCGCCCATGCCTGCTGCCCAAGGCATCCCTTGGGTCCTG
GAGCAGATCCTGTGCCTGCAGCAGCAGCAACTCCAGCAAATCCAGCTTACGGAACAGATTCGCGTCCAGG
TGAACATGTGGGCAGCGCACGCGCTCCACTCTGGAGTGGCGGGGGCCGACACGCTGAAGGCCTTAAGCAG
CCATGTGTCTCAGCAAGTGTCCGTGTCCCAGCAGGTGTCGGCTGCCGTGGCCCTGCTCAGCCAGAAAGCC
TCAAACCCAGCTCTGTCGCTCGATGCCTTGAAACAAGCCAAGCTACCTCATGCCAGCGTCCCCTCCGCAG
CCAGCCCGTTGTCCTCGGGGTTAACGTCCTTCACCTTGAAGCCTGACGGGACACGGGTTCTCCCCAACTT
CGTGTCTCGCCTTCCCAGTGCCCTGCTACCTCAGACTCCGGGCTCTGTGCTCCTGCAGAGTCCCTTCTCC
GCTGTGACGCTCGACCAGTCCAAGAAAGGAAAGGGGAAACCCCAGAACCTCTCCGCCTCTGCCTCGGTGT
TAGATGTCAAGGCCAAGGACGAAGTCGTCCTCGGTAAGCACAAGTGTAGGTACTGTCCCAAGGTTTTCGG
GACAGATAGCTCCCTTCAGATTCACCTTCGCTCCCACACCGGAGAGAGACCTTACGTGTGCCCTATCTGT
GGTCACCGCTTCACCACCAAGGGCAATCTCAAGGTCCACTTACAACGACACCCTGAGGTGAAGGCAAACC
CCCAGCTGTTGGCCGAATTCCAGGACAAAGGGGCAGTGAGTGCCGCTTCTCACTATGCACTCCCTGTCCC
CGTCCCTGCCGATGAATCGAGTCTCTCTGTAGACGCCGAGCCTGTCCCGGTCACGGGAACCCCTTCTCTA
GGGCTACCTCAAAAGCTCACGTCAGGGCCTAATTCCAGGGACCTCATGGGTGGCTCCTTGCCCAATGACA
TGCAGCCAGGGCCTTCTCCAGAAAGTGAGGCGGGCCTTCCACTCCTTGGGGTGGGGATGATACATAATCC
CCCAAAGGCTGGGGGCTTCCAGGGCACTGGGGCCCCAGAGTCAGGGTCCGAGACCCTGAAATTGCAGCAA
CTAGTGGAGAACATAGACAAGGCCACTACTGACCCCAACGAGTGTCTCATTTGTCATCGGGTCCTCAGCT
GTCAGAGTTCCCTGAAGATGCATTACCGTACCCACACAGGGGAGAGACCATTCCAGTGCAAGATCTGTGG
CCGGGCCTTCTCCACCAAAGGCAACCTGAAGACACACCTTGGGGTTCACCGAACCAACACGACCGTAAAG
ACCCAACATTCGTGCCCCATCTGCCAGAAGAAATTCACCAACGCCGTCATGTTACAGCAGCATATCCGGA
TGCACATGGGTGGCCAGATCCCCAACACCCCTCTGCCAGAGAGTCCCTGTGACTTCACGGCTCCCGAGCC
CGTGGCCGTCAGTGAGAATGGCAGTGCCAGCGGGGTCTGCCAGGACGACGCAGCAGAAGGGATGGAAGCC
GAGGAGGTCTGTTCTCAGGATGTTCCCAGTGGCCCCTCAACTGTCTCTCTGCCGGTTCCCAGTGCCCACC
TGGCATCGCCCTCTCTGGGCTTCTCTGTGTTGGCCTCCCTGGATACGCAGGGGAAAGGGGCTCTTCCGGC
GCTGGCCCTGCAGAGGCAGAGCAGTCGAGAAAACAGCTCCCTGGAGGGCGGTGACACTGGTCCAGCCAAT
GACTCTTCCTTGCTCGTGGGTGACCAGGAGTGTCAGAGCCGAAGCCCAGATGCCACGGAGACCATGTGCT
ACCAGGCAGTGTCACCTGCCAATAGCCAAGCCGGAAGTGTCAAGTCCCGGTCTCCCGAGGGTCACAAGGC
CGAGGGCGTGGAGAGCTGCCGCGTTGACACCGAAGGTCGTACCAGCCTCCCTCCAACATTTATCCGAGCA
CAGCCCACCTTTGTCAAAGTTGAAGTGCCTGGCACCTTTGTGGGACCCCCCAGCATGCCCTCGGGTATGC
CGCCTTTGCTAGCATCGCAGCCGCAGCCACGCCGCCAGGCCAAGCAGCACTGCTGCACACGGTGTGGAAA
GAACTTCTCGTCTGCCAGTGCCCTGCAGATCCACGAGCGAACACACACGGGAGAGAAGCCTTTCGTGTGT
AACATATGCGGGCGGGCCTTCACCACGAAAGGCAACCTGAAGGTACACTACATGACTCATGGGGCCAACA
ATAACTCCGCCCGCCGGGGAAGGAAGCTGGCCATAGAGAACCCCATGGCCGCGCTGAGTGCTGAGGGAAA
GAGAGCGCCCGAGGTGTTTTCCAAGGAGCTCCTGTCCCCCGCGGTGAGTGTGGACCCCGCCTCCTGGAAC
CAGTACACCAGCGTCCTGAATGGGGGTCTGGCCATGAAGACCAACGAGATCTCCGTGATCCAGAGCGGAG
GCATCCCCACGCTGCCTGTGTCGCTGGGGGCCAGCTCTGTGGTGAGCAATGGCACGATTTCCAAGCTTGA
CGGCTCTCAGACCGGTGTGAGCATGCCCATGAGCGGGAACGGAGAAAAGCTCGCTGTTCCCGACGGCATG
GCCAAACACCAGTTCCCTCACTTCCTGGAGGAAAATAAGATTGCTGTCAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227483 representing NM_175303
Red=Cloning site Green=Tags(s)

MSRRKQAKPQHINWEEGQGEQPQQLPSPDLAEALAAEEPGAPVNSPGNCDEASEDSIPVKRPRREDTHIC
NKCCAEFFSLSEFMEHKKSCTKTPPVLIMNDSEGPVPSEDFSRAALSHQLGSPSNKDSLQENGSSSGDLK
KLGTDSILYLKTEATQPSTPQDISYLPKGKVANTNVTLQALRGTKVAVNQRGAEAPMAPMPAAQGIPWVL
EQILCLQQQQLQQIQLTEQIRVQVNMWAAHALHSGVAGADTLKALSSHVSQQVSVSQQVSAAVALLSQKA
SNPALSLDALKQAKLPHASVPSAASPLSSGLTSFTLKPDGTRVLPNFVSRLPSALLPQTPGSVLLQSPFS
AVTLDQSKKGKGKPQNLSASASVLDVKAKDEVVLGKHKCRYCPKVFGTDSSLQIHLRSHTGERPYVCPIC
GHRFTTKGNLKVHLQRHPEVKANPQLLAEFQDKGAVSAASHYALPVPVPADESSLSVDAEPVPVTGTPSL
GLPQKLTSGPNSRDLMGGSLPNDMQPGPSPESEAGLPLLGVGMIHNPPKAGGFQGTGAPESGSETLKLQQ
LVENIDKATTDPNECLICHRVLSCQSSLKMHYRTHTGERPFQCKICGRAFSTKGNLKTHLGVHRTNTTVK
TQHSCPICQKKFTNAVMLQQHIRMHMGGQIPNTPLPESPCDFTAPEPVAVSENGSASGVCQDDAAEGMEA
EEVCSQDVPSGPSTVSLPVPSAHLASPSLGFSVLASLDTQGKGALPALALQRQSSRENSSLEGGDTGPAN
DSSLLVGDQECQSRSPDATETMCYQAVSPANSQAGSVKSRSPEGHKAEGVESCRVDTEGRTSLPPTFIRA
QPTFVKVEVPGTFVGPPSMPSGMPPLLASQPQPRRQAKQHCCTRCGKNFSSASALQIHERTHTGEKPFVC
NICGRAFTTKGNLKVHYMTHGANNNSARRGRKLAIENPMAALSAEGKRAPEVFSKELLSPAVSVDPASWN
QYTSVLNGGLAMKTNEISVIQSGGIPTLPVSLGASSVVSNGTISKLDGSQTGVSMPMSGNGEKLAVPDGM
AKHQFPHFLEENKIAVS

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_175303
ORF Size 3201 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_175303.4, NP_780512.2
RefSeq Size 5073 bp
RefSeq ORF 3204 bp
Locus ID 99377
UniProt ID Q8BX22
Cytogenetics 2 88.99 cM
MW 113.6 kDa
Gene Summary This gene belongs to the spalt family of zinc finger transcription factors. In mouse, functions for this gene have been described in many embryonic developmental processes, including brain, heart, and limb development. In addition, this gene is an important pluripotency factor that is required for stem cell maintenance. Homozygous mutant mice display embryonic lethality, while conditional knock-out in embryonic germ cells results in failure to establish a robust stem cell population. A pseudogene of this gene is found on chromosome 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Other Versions

Frequently bought together (4)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 177.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.