Akt1 (NM_001165894) Mouse Tagged ORF Clone

CAT#: MR227413

Akt1 (Myc-DDK-tagged) - Mouse thymoma viral proto-oncogene 1 (Akt1), transcript variant 2

Change vector?

  • TrueORF®

USD 98

USD 610


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Akt1 (NM_001165894) Mouse Tagged ORF Clone
Symbol Akt1
Synonyms Akt; LTR-akt; PKB; PKB/Akt; PKBalpha; Rac
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR227413 representing NM_001165894
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACGACGTAGCCATTGTGAAGGAGGGCTGGCTGCACAAACGAGGGGAATATATTAAAACCTGGCGGC
CACGCTACTTCCTCCTCAAGAACGATGGCACCTTTATTGGCTACAAGGAACGGCCTCAGGATGTGGATCA
GCGAGAGTCCCCACTCAACAACTTCTCAGTGGCACAATGCCAGCTGATGAAGACAGAGCGGCCAAGGCCC
AACACCTTTATCATCCGCTGCCTGCAGTGGACCACAGTCATTGAGCGCACCTTCCATGTGGAAACGCCTG
AGGAGCGGGAAGAATGGGCCACCGCCATTCAGACTGTGGCAGATGGACTCAAGAGGCAGGAAGAAGAGAC
GATGGACTTCCGATCAGGCTCACCCAGTGACAACTCAGGGGCTGAAGAGATGGAGGTGTCCCTGGCCAAG
CCCAAGCACCGTGTGACCATGAACGAGTTTGAGTACCTGAAGCTACTGGGCAAGGGCACCTTTGGGAAGG
TGATTCTGGTGAAAGAGAAGGCCACAGGCCGCTACTATGCCATGAAGATCCTCAAGAAGGAGGTCATCGT
CGCCAAGGATGAGGTTGCCCACACGCTTACTGAGAACCGTGTCCTGCAGAACTCTAGGCATCCCTTCCTT
ACGGCCCTCAAGTACTCATTCCAGACCCACGACCGCCTCTGCTTTGTCATGGAGTATGCCAACGGGGGCG
AGCTCTTCTTCCACCTGTCTCGAGAGCGTGTGTTCTCCGAGGACCGGGCCCGCTTCTATGGTGCGGAGAT
TGTGTCTGCCCTGGACTACTTGCACTCCGAGAAGAACGTGGTGTACCGGGACCTGAAGCTGGAGAACCTC
ATGCTGGACAAGGACGGGCACATCAAGATAACGGACTTCGGGCTGTGCAAGGAGGGGATCAAGGACGGTG
CCACTATGAAGACATTCTGCGGAACGCCGGAGTACCTGGCCCCTGAGGTGCTGGAGGACAACGACTACGG
CCGTGCAGTGGACTGGTGGGGGCTGGGCGTGGTCATGTACGAGATGATGTGTGGCCGCCTGCCCTTCTAC
AACCAGGACCACGAGAAGCTGTTCGAGCTGATCCTCATGGAGGAGATCCGCTTCCCGCGCACACTCGGCC
CTGAGGCCAAGTCCCTGCTCTCCGGGCTGCTCAAGAAGGACCCTACACAGAGGCTCGGTGGGGGCTCCGA
GGATGCCAAGGAGATCATGCAGCACCGGTTCTTTGCCAACATCGTGTGGCAGGATGTGTATGAGAAGAAG
CTGAGCCCACCTTTCAAGCCCCAGGTCACCTCTGAGACTGACACCAGGTATTTCGATGAGGAGTTCACAG
CTCAGATGATCACCATCACGCCGCCTGATCAAGTTCTCCTACTCAGCCAGTGGCACAGCCTGAGGCCTGG
GGCAGCGGCTGGCAGCTCCACGCTCCTCTGCATTGCCGAGTCCAGAAGCCCCGCATGGATCATC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227413 representing NM_001165894
Red=Cloning site Green=Tags(s)

MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQCQLMKTERPRP
NTFIIRCLQWTTVIERTFHVETPEEREEWATAIQTVADGLKRQEEETMDFRSGSPSDNSGAEEMEVSLAK
PKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFL
TALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENL
MLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFY
NQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQVLLLSQWHSLRPGAAAGSSTLLCIAESRSPAWII

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001165894
ORF Size 1464 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001165894.1, NP_001159366
RefSeq Size 2657
RefSeq ORF 1467
Locus ID 11651
Cytogenetics 12 F1|12 61.2 cM
MW 56.4 kDa
Gene Summary This gene encodes the founding member of the Akt serine-threonine protein kinase gene family that also includes Akt2 and Akt3. This kinase is a major downstream effector of the phosphatidylinositol 3-kinase (PI3K) pathway that mediates the effects of various growth factors such as platelet-derived growth factor (PDGF), epidermal growth factor (EGF), insulin and insulin-like growth factor I (IGF-I). It is activated through recruitment to cellular membranes by PI3K lipid products and by phosphorylation by 3-phosphoinositide dependent kinase-1. It then further phosphorylates different downstream proteins in response to various extracellular signals and thus plays a pivotal role in mediating a variety of cellular processes, such as glucose metabolism, glycogen biosynthesis, protein synthesis and turn over, inflammatory response, cell survival (anti-apoptosis) and development. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.