Ikbkg (NM_001161423) Mouse Tagged ORF Clone

CAT#: MR227224

Reviews ()
Write a review
  • TrueORF®

Ikbkg (Myc-DDK-tagged) - Mouse inhibitor of kappaB kinase gamma (Ikbkg), transcript variant 6



  "NM_001161423" in other vectors (3)

Interest in protein/lysate? Submit request here!

USD 488.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Ikbkg
Synonyms 1110037D23Rik; AI848108; AI851264; AW124339; IKK[g]; NEMO
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR227224 representing NM_001161423
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAACAAGCACCCCTGGAAGAACCAGCTGAGTGAGATGGTGCAGCCCAGTGGTGGCCCAGCAGAGGACC
AGGACATGCTGGGTGAAGAATCTTCTCTGGGGAAGCCTGCAATGCTACATCTGCCTTCAGAGCAGGGTAC
TCCTGAGACCCTCCAGCGCTGCCTGGAAGAGAATCAAGAGCTCCGAGACGCTATCCGGCAGAGCAATCAG
ATGCTGAGGGAACGCTGTGAGGAGCTGCTGCATTTCCAGGTCAGCCAGCGGGAGGAGAAGGAGTTCCTTA
TGTGCAAATTCCAGGAAGCCCGGAAGCTGGTGGAGAGACTGAGCTTGGAGAAGCTTGATCTTCGGAGTCA
GAGGGAACAGGCCTTAAAGGAGTTGGAGCAACTGAAGAAATGCCAACAGATGGCTGAGGACAAGGCCTCT
GTGAAAGCTCAGGTGACATCATTGCTCGGAGAACTCCAGGAGAGCCAGAGCCGTTTGGAGGCTGCCACCA
AGGATCGGCAAGCTTTAGAGGGAAGGATTCGAGCAGTTAGTGAGCAGGTCAGACAGCTGGAGAGTGAGCG
GGAGGTGCTACAGCAGCAGCACAGCGTCCAGGTGGACCAGCTGCGTATGCAGAACCAGAGCGTGGAGGCT
GCCTTGCGAATGGAGCGGCAGGCTGCTTCAGAGGAGAAGCGGAAGCTGGCTCAGTTGCAGGCAGCCTATC
ACCAGCTCTTCCAAGACTACGACAGCCACATTAAGAGCAGCAAGGGCATGCAGCTGGAAGATCTGAGGCA
ACAGCTCCAGCAAGCTGAGGAGGCCCTGGTAGCCAAACAGGAATTGATTGATAAGCTGAAAGAGGAGGCT
GAGCAGCACAAGATTGTGATGGAGACTGTGCCAGTCTTGAAGGCCCAGGCGGATATCTACAAGGCTGACT
TCCAAGCTGAGAGGCATGCCCGGGAGAAGCTGGTGGAGAAGAAGGAGTATTTGCAGGAGCAGCTGGAGCA
GCTGCAGCGCGAGTTCAACAAGCTGAAAGTTGGCTGCCATGAGTCAGCCAGGATTGAGGATATGAGGAAG
CGGCATGTAGAGACTCCCCAGCCTCCTTTACTCCCTGCTCCAGCTCACCACTCCTTTCATTTGGCCTTGT
CCAACCAGCGGAGGAGCCCTCCTGAAGAACCTCCTGACTTCTGTTGTCCGAAGTGCCAGTATCAGGCTCC
TGATATGGACACTCTACAGATACATGTCATGGAGTGCATAGAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR227224 representing NM_001161423
Red=Cloning site Green=Tags(s)

MNKHPWKNQLSEMVQPSGGPAEDQDMLGEESSLGKPAMLHLPSEQGTPETLQRCLEENQELRDAIRQSNQ
MLRERCEELLHFQVSQREEKEFLMCKFQEARKLVERLSLEKLDLRSQREQALKELEQLKKCQQMAEDKAS
VKAQVTSLLGELQESQSRLEAATKDRQALEGRIRAVSEQVRQLESEREVLQQQHSVQVDQLRMQNQSVEA
ALRMERQAASEEKRKLAQLQAAYHQLFQDYDSHIKSSKGMQLEDLRQQLQQAEEALVAKQELIDKLKEEA
EQHKIVMETVPVLKAQADIYKADFQAERHAREKLVEKKEYLQEQLEQLQREFNKLKVGCHESARIEDMRK
RHVETPQPPLLPAPAHHSFHLALSNQRRSPPEEPPDFCCPKCQYQAPDMDTLQIHVMECIE

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001161423
ORF Size 1233 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001161423.1, NP_001154895.1
RefSeq Size 6788 bp
RefSeq ORF 1239 bp
Locus ID 16151
UniProt ID O88522
Cytogenetics X A7.3
MW 48.4 kDa
Gene Summary Regulatory subunit of the IKK core complex which phosphorylates inhibitors of NF-kappa-B thus leading to the dissociation of the inhibitor/NF-kappa-B complex and ultimately the degradation of the inhibitor. Its binding to scaffolding polyubiquitin seems to play a role in IKK activation by multiple signaling receptor pathways. Also considered to be a mediator for TAX activation of NF-kappa-B. Could be implicated in NF-kappa-B-mediated protection from cytokine toxicity. Involved in TLR3- and IFIH1-mediated antiviral innate response; this function requires 'Lys-27'-linked polyubiquitination.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Ikbkg"
Frequently bought together (3)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 165.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 627.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 149.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools