Vegfa (NM_001025257) Mouse Tagged ORF Clone

  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

SKU
MR227100
Vegfa (Myc-DDK-tagged) - Mouse vascular endothelial growth factor A (Vegfa), transcript variant 3
$330.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Vegfa
Synonyms V; Veg; Vegf; VEGF12; VEGF16; VEGF18; Vpf
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR227100 representing NM_001025257
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

CTGACGGACAGACAGACAGACACCGCCCCCAGCCCCAGCGCCCACCTCCTCGCCGGCGGGCTGCCGACGG
TGGACGCGGCGGCGAGCCGCGAGGAACCGAAGCCCGCGCCCGGAGGCGGGGTGGAGGGGGTCGGGGCTCG
CGGGATTGCACGGAAACTTTTCGTCCAACTTCTGGGCTCTTCTCGCTCCGTAGTAGCCGTGGTCTGCGCC
GCAGGAGACAAACCGATCGGAGCTGGGAGAAGTGCTAGCTCGGGCCTGGAGAAGCCGGGGCCCGAGAAGA
GAGGGGAGGAAGAGAAGGAAGAGGAGAGGGGGCCGCAGTGGGCGCTCGGCTCTCAGGAGCCGAGCTCATG
GACGGGTGAGGCGGCCGTGTGCGCAGACAGTGCTCCAGCCGCGCGCGCGCCCCAGGCCCCGGCCCGGGCC
TCGGTTCCAGAAGGGAGAGGAGCCCGCCAAGGCGCGCAAGAGAGCGGGCTGCCTCGCAGTCCGAGCCGGA
GAGGGAGCGCGAGCCGCGCCGGCCCCGGACGGGCCTCCGAAACCATGAACTTTCTGCTCTCTTGGGTGCA
CTGGACCCTGGCTTTACTGCTGTACCTCCACCATGCCAAGTGGTCCCAGGCTGCACCCACGACAGAAGGA
GAGCAGAAGTCCCATGAAGTGATCAAGTTCATGGATGTCTACCAGCGAAGCTACTGCCGTCCGATTGAGA
CCCTGGTGGACATCTTCCAGGAGTACCCCGACGAGATAGAGTACATCTTCAAGCCGTCCTGTGTGCCGCT
GATGCGCTGTGCAGGCTGCTGTAACGATGAAGCCCTGGAGTGCGTGCCCACGTCAGAGAGCAACATCACC
ATGCAGATCATGCGGATCAAACCTCACCAAAGCCAGCACATAGGAGAGATGAGCTTCCTACAGCACAGCA
GATGTGAATGCAGACCAAAGAAAGACAGAACAAAGCCAGAAAAATGTGACAAGCCAAGGCGG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR227100 representing NM_001025257
Red=Cloning site Green=Tags(s)

LTDRQTDTAPSPSAHLLAGGLPTVDAAASREEPKPAPGGGVEGVGARGIARKLFVQLLGSSRSVVAVVCA
AGDKPIGAGRSASSGLEKPGPEKRGEEEKEEERGPQWALGSQEPSSWTGEAAVCADSAPAARAPQAPARA
SVPEGRGARQGAQESGLPRSPSRRGSASRAGPGRASETMNFLLSWVHWTLALLLYLHHAKWSQAAPTTEG
EQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNIT
MQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_001025257
ORF Size 972 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_001025257.3, NP_001020428.2
RefSeq Size 3343 bp
RefSeq ORF 975 bp
Locus ID 22339
UniProt ID Q00731
Cytogenetics 17 22.79 cM
MW 35.5 kDa
Summary This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site.[provided by RefSeq, Nov 2015]
 
 
 
 
 
Be the first to review this product
SKU Description Size Price
MC209635 Vegfa (untagged) - Mouse vascular endothelial growth factor A (Vegfa), transcript variant 3, (10ug) 10 ug
$330.00
MG227100 Vegfa (tGFP-tagged) - Mouse vascular endothelial growth factor A (Vegfa) transcript variant 3, (10ug) 10 ug
$530.00
MR227100L3 Lenti ORF clone of Vegfa (Myc-DDK-tagged) - Mouse vascular endothelial growth factor A (Vegfa), transcript variant 3 10 ug
$630.00
MR227100L4 Lenti ORF clone of Vegfa (mGFP-tagged) - Mouse vascular endothelial growth factor A (Vegfa), transcript variant 3 10 ug
$630.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.