Igf1 (NM_010512) Mouse Tagged ORF Clone
CAT#: MR227062
- TrueORF®
Igf1 (Myc-DDK-tagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1
ORF Plasmid: tGFP
Lentiviral Particles: DDK w/ Puro mGFP w/ Puro
"NM_010512" in other vectors (4)
Interest in protein/lysate? Submit request here!
USD 198.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | Igf1 |
Synonyms | C730016P09Rik; Igf; Igf-; Igf-1; Igf-I |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR227062 representing NM_010512
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGGGAAAATCAGCAGCCTTCCAACTCAATTATTTAAGATCTGCCTCTGTGACTTCTTGAAGATAAAGA TACACATCATGTCGTCTTCACACCTCTTCTACCTGGCGCTCTGCTTGCTCACCTTCACCAGCTCCACCAC AGCTGGACCAGAGACCCTTTGCGGGGCTGAGCTGGTGGATGCTCTTCAGTTCGTGTGTGGACCGAGGGGC TTTTACTTCAACAAGCCCACAGGCTATGGCTCCAGCATTCGGAGGGCACCTCAGACAGGCATTGTGGATG AGTGTTGCTTCCGGAGCTGTGATCTGAGGAGACTGGAGATGTACTGTGCCCCACTGAAGCCTACAAAAGC AGCCCGCTCTATCCGTGCCCAGCGCCACACTGACATGCCCAAGACTCAGAAGTCCCCGTCCCTATCGACA AACAAGAAAACGAAGCTGCAAAGGAGAAGGAAAGGAAGTACATTTGAAGAACACAAG ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR227062 representing NM_010512
Red=Cloning site Green=Tags(s) MGKISSLPTQLFKICLCDFLKIKIHIMSSSHLFYLALCLLTFTSSTTAGPETLCGAELVDALQFVCGPRG FYFNKPTGYGSSIRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPTKAARSIRAQRHTDMPKTQKSPSLST NKKTKLQRRRKGSTFEEHK myc-FLAG tag |
Chromatograms |
CHROMATOGRAMS
Sequencher program is needed, download here. |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene Plasmid Map |
ACCN | NM_010512 |
ORF Size | 477 bp |
OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Reference Data | |
RefSeq | NM_010512.5 |
RefSeq Size | 7121 bp |
RefSeq ORF | 480 bp |
Locus ID | 16000 |
UniProt ID | P05017 |
Cytogenetics | 10 43.7 cM |
MW | 18.3 kDa |
Gene Summary | This gene encodes a member of the insulin-like growth factor (IGF) family of proteins that promote growth and development during fetal and postnatal life. This gene is predominantly expressed in the liver and the encoded protein undergoes proteolytic processing to generate a disulfide-linked mature polypeptide. Transgenic disruption of this gene in mice results in reduced postnatal survival and severe growth retardation. Mice lacking the encoded protein exhibit generalized organ hypoplasia including underdevelopment of the central nervous system and developmental defects in bone, muscle and reproductive systems. Alternative splicing results in multiple transcript variants encoding different isoforms that may undergo similar processing to generate mature protein. [provided by RefSeq, Sep 2015] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC208756 | Igf1 (untagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1, (10ug) |
USD 225.00 |
|
MG227062 | Igf1 (tGFP-tagged) - Mouse insulin-like growth factor 1 (Igf1) transcript variant 1, (10ug) |
USD 425.00 |
|
MR227062L3 | Lenti ORF clone of Igf1 (Myc-DDK-tagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1 |
USD 525.00 |
|
MR227062L4 | Lenti ORF clone of Igf1 (mGFP-tagged) - Mouse insulin-like growth factor 1 (Igf1), transcript variant 1 |
USD 525.00 |
{0} Product Review(s)
Be the first one to submit a review