Dlx5 (NM_010056) Mouse Tagged ORF Clone

  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

SKU
MR226751
Dlx5 (Myc-DDK-tagged) - Mouse distal-less homeobox 5 (Dlx5), transcript variant 1
$450.00
In Stock*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Dlx5
Synonyms AI385752
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR226751 representing NM_010056
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGACAGGAGTGTTTGACAGAAGAGTCCCAAGCATCCGATCCGGCGACTTCCAAGCTCCGTTCCCGACGT
CCGCCGCCATGCACCACCCGTCTCAGGAATCGCCAACTTTGCCCGAGTCCTCGGCCACCGATTCTGACTA
CTACAGTCCCGCGGGGGCCGCCCCGCACGGCTACTGCTCTCCTACCTCTGCTTCTTATGGCAAAGCGCTC
AACCCCTACCAGTACCAGTACCACGGCGTGAACGGCTCCGCAGCCGGCTACCCGGCCAAGGCTTATGCCG
ACTACGGCTACGCCAGCCCCTACCACCAGTACGGCGGCGCCTACAACCGCGTCCCGAGTGCCACCAGCCA
GCCAGAGAAAGAAGTGGCGGAGCCAGAGGTGAGGATGGTGAATGGTAAACCAAAGAAAGTTCGTAAACCC
AGGACTATTTATTCCAGCTTTCAGCTGGCCGCTTTACAGAGAAGGTTTCAGAAGACTCAGTACCTCGCCC
TGCCAGAACGCGCGGAGTTGGCCGCCTCTCTAGGACTGACGCAAACACAGGTGAAAATCTGGTTTCAGAA
CAAAAGATCCAAGATCAAGAAGATCATGAAAAACGGGGAGATGCCCCCGGAGCACAGTCCCAGCTCCAGC
GACCCTATGGCGTGTAACTCGCCACAGTCACCAGCGGTGTGGGAGCCCCAGGGCTCATCCCGCTCTCTCA
GCCACCACCCTCATGCCCACCCTCCGACCTCCAACCAGTCCCCCGCGTCCAGCTACCTGGAGAACTCGGC
TTCCTGGTACCCAAGCGCAGCCAGCTCAATCAATTCCCACCTGCCACCGCCGGGCTCCTTGCAGCACCCG
CTGGCACTGGCCTCCGGGACGCTTTAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226751 representing NM_010056
Red=Cloning site Green=Tags(s)

MTGVFDRRVPSIRSGDFQAPFPTSAAMHHPSQESPTLPESSATDSDYYSPAGAAPHGYCSPTSASYGKAL
NPYQYQYHGVNGSAAGYPAKAYADYGYASPYHQYGGAYNRVPSATSQPEKEVAEPEVRMVNGKPKKVRKP
RTIYSSFQLAALQRRFQKTQYLALPERAELAASLGLTQTQVKIWFQNKRSKIKKIMKNGEMPPEHSPSSS
DPMACNSPQSPAVWEPQGSSRSLSHHPHAHPPTSNQSPASSYLENSASWYPSAASSINSHLPPPGSLQHP
LALASGTLY

myc-FLAG tag
Chromatograms Chromatograms
Sequencher program is needed, download here
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_010056
ORF Size 867 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_010056.3
RefSeq Size 1410 bp
RefSeq ORF 870 bp
Locus ID 13395
UniProt ID P70396
Cytogenetics 6 2.83 cM
MW 31.4 kDa
Summary Transcriptional factor involved in bone development. Acts as an immediate early BMP-responsive transcriptional activator essential for osteoblast differentiation. Stimulates ALPL promoter activity in a RUNX2-independent manner during osteoblast differentiation. Stimulates SP7 promoter activity during osteoblast differentiation. Promotes cell proliferation by up-regulating MYC promoter activity. Involved as a positive regulator of both chondrogenesis and chondrocyte hypertrophy in the endochondral skeleton. Binds to the homeodomain-response element of the ALPL and SP7 promoter. Binds to the MYC promoter. Requires the 5'-TAATTA-3' consensus sequence for DNA-binding.[UniProtKB/Swiss-Prot Function]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
MC208398 Dlx5 (untagged) - Mouse distal-less homeobox 5 (Dlx5), transcript variant 1, (10ug) 10 ug
$450.00
MG226751 Dlx5 (tGFP-tagged) - Mouse distal-less homeobox 5 (Dlx5) transcript variant 1, (10ug) 10 ug
$650.00
MR226751L3 Lenti ORF clone of Dlx5 (Myc-DDK-tagged) - Mouse distal-less homeobox 5 (Dlx5), transcript variant 1 10 ug
$750.00
MR226751L4 Lenti ORF clone of Dlx5 (mGFP-tagged) - Mouse distal-less homeobox 5 (Dlx5), transcript variant 1 10 ug
$750.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.