Tcf7 (NM_009331) Mouse Tagged ORF Clone

CAT#: MR226713

  • TrueORF®

Tcf7 (Myc-DDK-tagged) - Mouse transcription factor 7, T-cell specific (Tcf7)

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK DDK w/ Puro mGFP mGFP w/ Puro

AAV Particle: DDK


  "NM_009331" in other vectors (6)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 300.00

In Stock*

Size
    • 10 ug

Product Images

Frequently bought together (5)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00


TCF7 Antibody - C-terminal region
    • 100 ul

USD 539.00

Other products for "Tcf7"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Tcf7
Synonyms AI465550; TCF-1; Tcf1
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR226713 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTACAAAGAGACTGTCTACTCTGCCTTCAATCTGCTCATGCCCTACCCACCGGCCTCGGGAGCAGGGC
AGCATCCGCAGCCTCAACCCCCGCTGCATAACAAGCCCGGCCAGCCTCCACATGGCGTCCCCCAGCTTTC
TCCACTCTACGAACATTTCAGCAGTCCACACCCCACCCCTGCACCAGCGGACATCAGCCAGAAGCAAGGA
GTTCACAGGCCGCTGCAGACCCCCGATCTCTCTGGATTTTATTCTCTGACCTCAGGCAGCATGGGACAGC
TCCCCCATACTGTGAGCTGGCCCAGTCCTCCTCTCTACCCCCTGTCCCCTTCCTGCGGATATAGACAGCA
CTTCCCTGCCCCCACTGCAGCCCCTGGCGCCCCCTATCCCAGGTTCACCCACCCATCCTTGATGCTGGGA
TCTGGTGTACCTGGACACCCAGCAGCCATCCCTCACCCGGCCATTGTGCCCTCCTCAGGGAAGCAGGAGC
TGCAGCCATATGATAGAAACCTGAAAACACAGGCAGAACCCAAGGCAGAGAAGGAGGCTAAGAAGCCAGT
CATCAAGAAACCCCTCAATGCGTTCATGCTTTACATGAAGGAGATGAGAGCCAAGGTCATTGCTGAGTGC
ACACTCAAGGAGAGCGCTGCCATCAACCAGATCCTGGGTCGCAGGTGGCATGCACTATCTCGAGAAGAGC
AGGCCAAGTACTATGAACTGGCCCGCAAGGAAAGGCAGCTGCACATGCAGCTATACCCGGGCTGGTCCGC
GCGGGATAACTACGGAAAGAAGAAGAGGCGGTCAAGGGAAAAACATCAAGAATCCACCACAGGAGGAAAA
AGAAATGCATTCGGTACTTACCCGGAGAAGGCCGCTGCCCCAGCCCCGTTCCTTCCGATGACAGTGCTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR226713 protein sequence
Red=Cloning site Green=Tags(s)

MYKETVYSAFNLLMPYPPASGAGQHPQPQPPLHNKPGQPPHGVPQLSPLYEHFSSPHPTPAPADISQKQG
VHRPLQTPDLSGFYSLTSGSMGQLPHTVSWPSPPLYPLSPSCGYRQHFPAPTAAPGAPYPRFTHPSLMLG
SGVPGHPAAIPHPAIVPSSGKQELQPYDRNLKTQAEPKAEKEAKKPVIKKPLNAFMLYMKEMRAKVIAEC
TLKESAAINQILGRRWHALSREEQAKYYELARKERQLHMQLYPGWSARDNYGKKKRRSREKHQESTTGGK
RNAFGTYPEKAAAPAPFLPMTVL

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_009331
ORF Size 912 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_009331.1
RefSeq Size 2238 bp
RefSeq ORF 912 bp
Locus ID 21414
UniProt ID Q00417
Cytogenetics 11 31.86 cM
MW 33.6 kDa
Gene Summary This gene encodes a transcription factor which is a member of the T-cell specific transcription factor family. The encoded protein is distinct from the hepatic transcription factor, transcription factor 1, which is also referred to by the symbol Tcf1. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. [provided by RefSeq, Sep 2015]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.