Cd44 (NM_001177787) Mouse Tagged ORF Clone

CAT#: MR226618

Cd44 (Myc-DDK-tagged) - Mouse CD44 antigen (Cd44), transcript variant 6

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 269.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cd44 (NM_001177787) Mouse Tagged ORF Clone
Symbol Cd44
Synonyms AU023126; AW121933; AW146109; HERMES; Ly-24; Pgp-1
Vector pCMV6-Entry
Sequence Data
>MR226618 representing NM_001177787
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGACAAGTTTTGGTGGCACACAGCTTGGGGACTTTGCCTCTTGCAGTTGAGCCTGGCACATCCACATC
AGCAGATCGATTTGAATGTAACCTGCCGCTACGCAGGTGTATTCCATGTGGAGAAAAATGGCCGCTACAG
TATCTCCCGGACTGAGGCAGCTGACCTCTGCCAGGCTTTCAACAGTACCTTACCCACCATGGACCAAATG
AAGTTGGCCCTGAGCAAGGGTTTTGAAACATGCAGGTATGGGTTCATAGAAGGAAATGTGGTAATTCCGA
GGATTCATCCCAACGCTATCTGTGCAGCCAACCACACAGGAGTATATATCCTCGTCACGTCCAACACCTC
CCACTATGACACATATTGCTTCAATGCCTCAGCCCCTCCTGAAGAAGACTGTACATCAGTCACAGACCTA
CCCAATTCCTTCGATGGACCGGTTACCATAACTATTGTCAACCGTGATGGTACTCGCTACAGCAAGAAGG
GCGAGTATAGAACACACCAAGAAGACATCGATGCTTCAAACATTATAGATGACGATGTCAGCAGCGGCTC
CACCATCGAGAAGAGCACCCCAGAAAGCTACATTTTGCACACCTACCTTCCTACTGAACAGCCTACTGGA
GATCAGGATGACTCCTTCTTTATCCGGAGCACCTTGGCCACCACACAGAGTCATTCTCAGAACTTCTCTA
CATTACATGGAGAGCCGGAAGAAGACGAAAACCATCCAACAACTTCTATTCTGCCATCTAGCACTAAGAG
CGGCGCTAAAGATGCAAGAAGAGGTGGAAGTCTTCCCACAGATACAACTACTTCTGTAGAAGGCTACACC
TTTCAATACCCAGACACAATGGAAAATGGGACTCTCTTCCCAGTGACCCCTGCTAAAACTGAGGTCTTTG
GAGAAACTGAAGTGACTCTTGCTACTGACTCCAACGTTAATGTTGATGGCTCCTTACCAGGAGATCGAGA
CTCATCCAAGGACTCCAGGGGGAGTTCCCGCACTGTGACTCATGGATCCGAATTAGCTGGACACTCAAGT
GCGAACCAGGACAGTGGAGTGACCACAACTTCTGGTCCTATGAGGAGACCTCAGATTCCAGAATGGCTCA
TCATCTTGGCATCTCTCCTGGCACTGGCTCTGATTCTTGCCGTCTGCATCGCGGTCAATAGTAGGAGAAG
GTGTGGGCAGAAGAAAAAGCTGGTGATCAACGGTGGCAATGGGACGGTGGAAGACAGGAAACCCAGTGAG
CTCAACGGGGAGGCCAGCAAGTCTCAGGAAATGGTGCATTTGGTGAACAAGGAACCATCAGAGACCCCGG
ACCAGTGTATGACAGCTGACGAGACCCGGAATCTGCAGAGTGTGGACATGAAGATTGGGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR226618 representing NM_001177787
Red=Cloning site Green=Tags(s)

MDKFWWHTAWGLCLLQLSLAHPHQQIDLNVTCRYAGVFHVEKNGRYSISRTEAADLCQAFNSTLPTMDQM
KLALSKGFETCRYGFIEGNVVIPRIHPNAICAANHTGVYILVTSNTSHYDTYCFNASAPPEEDCTSVTDL
PNSFDGPVTITIVNRDGTRYSKKGEYRTHQEDIDASNIIDDDVSSGSTIEKSTPESYILHTYLPTEQPTG
DQDDSFFIRSTLATTQSHSQNFSTLHGEPEEDENHPTTSILPSSTKSGAKDARRGGSLPTDTTTSVEGYT
FQYPDTMENGTLFPVTPAKTEVFGETEVTLATDSNVNVDGSLPGDRDSSKDSRGSSRTVTHGSELAGHSS
ANQDSGVTTTSGPMRRPQIPEWLIILASLLALALILAVCIAVNSRRRCGQKKKLVINGGNGTVEDRKPSE
LNGEASKSQEMVHLVNKEPSETPDQCMTADETRNLQSVDMKIGV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001177787
ORF Size 1392 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001177787.1, NP_001171258
RefSeq Size 4706
RefSeq ORF 1395
Locus ID 12505
Cytogenetics 2 E2|2 54.13 cM
MW 51.2 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)