Srsf7 (NM_001195487) Mouse Tagged ORF Clone

CAT#: MR226394

  • TrueORF®

Srsf7 (Myc-DDK-tagged) - Mouse serine/arginine-rich splicing factor 7 (Srsf7), transcript variant 4

ORF Plasmid: DDK tGFP

Lentiviral Particles: DDK w/ Puro mGFP w/ Puro


  "NM_001195487" in other vectors (4)


Interest in protein/lysate? Submit request here!

Reconstitution Protocol

USD 330.00

3 Weeks*

Size
    • 10 ug

Product Images

Frequently bought together (4)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 650.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

USD 160.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

USD 59.00


DDK Rabbit monoclonal antibody, recognizing both N- and C-terminal tags
    • 30 ul

USD 198.00

Other products for "Srsf7"

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Srsf7
Synonyms 9G8; 35kDa; 9430065L19Rik; NX-9; NX-96; Sf; Sfrs7
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MR226394 representing NM_001195487
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCACGCTACGGGCGGTATGGAGGAGAAACCAAGGTATATGTTGGTAACCTGGGAACTGGTGCTGGTA
AAGGAGAGTTAGAAAGGGCATTCAGTTACTATGGGCCCTTAAGAACTGTGTGGATTGCCAGAAATCCTCC
AGGATTCGCCTTTGTGGAATTTGAAGACCCTAGAGATGCAGAGGATGCAGTTCGAGGATTGGATGGGAAA
GTGATTTGTGGTTCTCGAGTGAGGGTTGAACTATCAACAGGCATGCCTCGGAGATCTCGTTTTGATAGGC
CACCTGCCCGTCGTCCCTTTGATCCTAATGATAGATGCTATGAGTGTGGTGAAAAGGGACATTATGCTTA
TGACTGTCATCGCTATAGCCGACGAAGAAGAAGCAGGTCACGATCTAGATCCCATTCCCGATCCAGGGGA
AGGCGATACTCTCGCTCCCGCAGCAGGAGCCGAGGACGGAGGTCAAGATCAGCATCTCCTCGCCGATCAA
GGTCTGTGTCTCTTCGTAGATCAAGATCAGCTTCACTCAGAAGATCTAGGTCTGGTTCTATAATAGGATC
GAGATCCCGCTCAAGGTCGAGATCAAGATCCAGGTCTATTTCACGACCAAGAAGCAGTCGTTCCCCATCA
GGAAGTCCACACAGAAGTGCAAGTCCAGAAAGAATGGAC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR226394 representing NM_001195487
Red=Cloning site Green=Tags(s)

MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGK
VICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRG
RRYSRSRSRSRGRRSRSASPRRSRSVSLRRSRSASLRRSRSGSIIGSRSRSRSRSRSRSISRPRSSRSPS
GSPHRSASPERMD

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001195487
ORF Size 669 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001195487.1, NP_001182416.1
RefSeq Size 2256 bp
RefSeq ORF 672 bp
Locus ID 225027
UniProt ID Q8BL97
Cytogenetics 17 E3
MW 26 kDa
Gene Summary The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Five transcript variants, four of them protein-coding and the other not protein-coding, have been found for this gene. [provided by RefSeq, Sep 2010]

Other Versions

{0} Product Review(s)

0 Product Review(s) Submit review

Be the first one to submit a review

Product Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.