Cav3 (NM_007617) Mouse Tagged ORF Clone

CAT#: MR226246

Cav3 (Myc-DDK-tagged) - Mouse caveolin 3 (Cav3)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 98.00

USD 390.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Cav3 (NM_007617) Mouse Tagged ORF Clone
Symbol Cav3
Synonyms AI385751; Cav-3; M-cav
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR226246 representing NM_007617
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGATGACCGAAGAGCACACGGATCTGGAAGCTCGGATCATCAAGGACATTCACTGCAAGGAGATAGACT
TGGTGAACCGCGACCCCAAGAACATCAATGAGGACATTGTGAAGGTAGATTTTGAAGACGTGATTGCGGA
GCCCGAGGGCACCTACAGCTTCGACGGTGTATGGAAGGTGAGCTTCACCACGTTCACCGTCTCCAAGTAC
TGGTGCTACCGCCTGTTGTCTACACTGCTGGGTGTTCCACTGGCCCTGCTCTGGGGATTCCTGTTCGCCT
GTATCTCCTTCTGCCACATCTGGGCCGTGGTGCCCTGCATTAAGAGCTACCTGATCGAGATCCAGTGCAT
CAGCCACATCTACTCACTGTGTATCCGCACCTTCTGCAACCCGCTCTTCGCTGCGTTGGGCCAGGTCTGC
AGCAACATTAAGGTGGTGCTGCGAAGGGAAGGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR226246 representing NM_007617
Red=Cloning site Green=Tags(s)

MMTEEHTDLEARIIKDIHCKEIDLVNRDPKNINEDIVKVDFEDVIAEPEGTYSFDGVWKVSFTTFTVSKY
WCYRLLSTLLGVPLALLWGFLFACISFCHIWAVVPCIKSYLIEIQCISHIYSLCIRTFCNPLFAALGQVC
SNIKVVLRREG

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_007617
ORF Size 453 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_007617.1, NM_007617.2, NM_007617.3, NP_031643
RefSeq Size 1172
RefSeq ORF 456
Locus ID 12391
Cytogenetics 6 E3|6 52.26 cM
MW 17.8 kDa
Gene Summary This gene belongs to the caveolin family whose members encode the major protein components of caveolae, which are invaginations of plasma membrane. The encoded protein is muscle-specific and forms homooligomers in muscle cells. The protein binds and regulates phosphofructokinase M and neuronal nitric oxide synthase. It also associates with dystrophin in muscle cells. Mutations in this gene are associated with muscular dystrophy. [provided by RefSeq, Apr 2013].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)