Erbb4 (NM_010154) Mouse Tagged ORF Clone

CAT#: MR225933

  • TrueORF®

Erbb4 (Myc-DDK-tagged) - Mouse v-erb-a erythroblastic leukemia viral oncogene homolog 4 (avian) (Erbb4)

 Cited in 1 publication.

  View "NM_010154" in other vectors (10)

USD 780.00

USD 1,648.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Erbb4 (NM_010154) Mouse Tagged ORF Clone
Symbol Erbb4
Synonyms c-erbB-4; Her4
Vector pCMV6-Entry
Sequence Data
>MR225933 representing NM_010154
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAAGCTGGCGACGGGACTCTGGGTCTGGGGGAGCCTTCTGATGGCAGCGGGGACCGTCCAGCCCAGCG
CTTCTCAGTCAGTGTGCGCAGGAACAGAGAACAAACTGAGCTCTCTCTCTGACCTGGAACAGCAGTACCG
AGCCTTGCGCAAATACTATGAAAACTGCGAGGTAGTCATGGGCAACCTGGAGATCACCAGCATCGAGCAC
AACCGGGACCTCTCCTTCCTGCGGTCTATCCGAGAAGTCACAGGCTACGTCCTGGTGGCCCTCAACCAGT
TTCGTTACTTGCCTCTGGAGAATTTACGCATTATTCGTGGGACAAAACTATATGAAGATCGCTATGCCTT
AGCGATATTCTTAAACTACAGGAAAGATGGCAACTTTGGACTCCAAGAACTTGGATTAAAGAACCTGACC
GAAATACTAAATGGTGGAGTCTATGTAGACCAGAACAAATTCCTATGTTATGCTGACACTATACACTGGC
AAGATATTGTTCGGAATCCATGGCCTTCCAACATGACTCTGGTGTCAACAAATGGAAGTTCTGGATGTGG
AAGATGCCATAAGTCTTGCACTGGCCGATGCTGGGGACCCACAGAAAATCACTGCCAGACCTTGACCAGA
ACTGTGTGTGCTGAACAATGTGATGGCAGGTGCTATGGACCCTACGTTAGTGACTGCTGCCATCGAGAAT
GTGCTGGAGGCTGCTCAGGACCAAAGGACACTGACTGCTTTGCCTGCATGAACTTCAATGACAGTGGAGC
CTGCGTTACTCAATGTCCCCAAACATTTGTCTACAATCCAACCACCTTTCAACTGGAACACAACTTCAAT
GCAAAGTACACGTATGGAGCATTCTGTGTTAAGAAATGTCCACATAACTTCGTGGTAGATTCCAGTTCTT
GTGTACGAGCCTGCCCTAGTTCTAAGATGGAAGTAGAAGAAAATGGGATTAAAATGTGTAAGCCTTGCAC
CGATATTTGCCCCAAAGCATGTGATGGAATCGGCACGGGATCACTGATGTCTGCTCAGACTGTGGATTCA
AGTAACATTGACAAATTCATAAACTGCACAAAGATCAATGGCAATCTCATCTTTCTTGTCACTGGCATTC
ATGGAGACCCTTACAATGCTATTGACGCCATAGATCCAGAGAAACTGAATGTCTTTCGGACTGTCAGAGA
AATAACAGGTTTCCTGAACATACAGTCTTGGCCCCCAAATATGACAGATTTCAGTGTTTTCTCCAACCTC
GTCACAATTGGAGGAAGAGTCCTCTACAGTGGTCTCTCATTGCTGATCCTCAAACAACAAGGTATCACTT
CCCTACAGTTCCAGTCTCTGAAGGAAATCAGTGCGGGCAATATCTACATCACTGACAACAGCAACCTGTG
TTATTACCATACCATTAACTGGACAACACTCTTCAGCACCATTAACCAGAGAATAGTGATCCGAGATAAC
AGAAGAGCTGAGAATTGTACTGCTGAAGGCATGGTATGCAACCACCTGTGTTCAAATGATGGTTGTTGGG
GACCTGGGCCGGACCAGTGCCTGTCATGTCGGCGCTTCAGCAGGGGAAAGATCTGCATAGAGTCTTGCAA
CCTTTATGATGGGGAATTTCGAGAGTTTGAAAACGGCTCCATCTGTGTTGAGTGTGACTCCCAGTGTGAG
AAAATGGAAGATGGACTCCTCACATGCCATGGACCGGGACCTGACAACTGCACAAAGTGCTCTCATTTTA
AGGATGGTCCAAACTGTGTGGAGAAATGTCCAGATGGCCTACAGGGAGCAAACAGTTTCATTTTTAAGTA
TGCAGATCAGGATCGGGAGTGCCACCCTTGCCATCCAAACTGCACCCAGGGGTGTAACGGTCCCACTAGT
CATGACTGCATTTACTACCCATGGACGGGCCATTCCACTTTACCACAACACGCTAGAACTCCACTGATTG
CAGCCGGAGTCATTGGAGGCCTCTTCATCCTGGTGATCATGGCTTTGACATTTGCTGTCTATGTCAGAAG
AAAGAGCATCAAAAAGAAACGTGCTTTGAGGAGATTCCTGGAGACAGAGCTGGTAGAGCCCTTAACTCCC
AGTGGCACGGCACCCAATCAAGCTCAACTTCGCATTTTGAAGGAAACCGAACTAAAGAGGGTAAAGGTCC
TTGGCTCGGGAGCTTTTGGAACCGTTTATAAAGGTATTTGGGTGCCTGAAGGTGAAACAGTGAAAATCCC
TGTGGCTATAAAGATCCTCAATGAAACAACTGGCCCCAAAGCCAACGTGGAGTTCATGGATGAGGCTCTG
ATCATGGCAAGTATGGATCACCCACACCTAGTTCGCCTATTGGGAGTGTGTCTGAGTCCCACTATCCAGT
TGGTTACGCAGCTGATGCCGCATGGCTGCCTACTGGACTATGTTCATGAACACAAGGATAACATTGGATC
ACAGCTGCTGTTGAACTGGTGTGTCCAGATTGCTAAGGGAATGATGTACCTAGAAGAAAGACGGCTTGTT
CATCGGGATCTGGCAGCCCGCAATGTCTTAGTGAAATCTCCAAATCATGTTAAAATCACAGATTTTGGAC
TGGCCCGGCTCTTGGAAGGAGATGAAAAAGAATACAATGCTGATGGTGGCAAGATGCCAATTAAATGGAT
GGCTCTGGAATGTATACATTATAGGAAATTCACACATCAAAGTGATGTTTGGAGCTATGGCGTCACTATA
TGGGAACTGATGACCTTTGGAGGAAAGCCCTATGATGGAATTCCAACCCGAGAAATCCCCGATTTACTGG
AGAAAGGAGAGCGTCTGCCTCAGCCTCCCATCTGCACTATTGATGTTTACATGGTCATGGTCAAATGTTG
GATGATCGATGCTGACAGCAGACCTAAATTCAAAGAACTGGCTGCTGAGTTTTCAAGAATGGCTAGAGAC
CCTCAAAGATACCTAGTTATTCAGGGTGATGATCGTATGAAGCTTCCCAGTCCAAATGACAGCAAATTCT
TCCAGAATCTCTTGGATGAAGAGGATTTGGAAGACATGATGGATGCTGAGGAATATTTGGTCCCCCAGGC
TTTCAACATACCTCCTCCCATCTACACATCCAGAACAAGAATTGACTCCAATAGGAATCAGTTTGTGTAC
CAAGATGGGGGCTTTGCTACACAACAAGGAATGCCCATGCCCTACAGAGCCACAACCAGCACCATACCAG
AGGCTCCAGTAGCTCAGGGTGCAACGGCTGAGATGTTTGATGACTCCTGCTGTAATGGTACCCTACGAAA
GCCAGTGGCACCCCATGTCCAAGAGGACAGTAGCACTCAGAGGTATAGTGCTGATCCCACAGTGTTCGCC
CCAGAACGGAATCCTCGAGGAGAACTGGATGAAGAAGGCTACATGACTCCAATGCATGACAAGCCCAAAC
AAGAATATCTGAATCCTGTGGAAGAGAACCCTTTTGTGTCCCGAAGGAAGAATGGAGATCTTCAAGCTTT
AGATAATCCGGAGTATCACAGTGCTTCCAGCGGTCCACCCAAGGCGGAGGATGAATACGTGAATGAGCCT
CTATACCTCAACACCTTCGCCAATGCCTTGGGGAGTGCAGAGTACATGAAAAACAGTGTACTGTCTGTGC
CAGAGAAAGCCAAGAAAGCATTTGACAACCCCGACTACTGGAACCACAGCCTGCCACCCCGGAGCACCCT
TCAGCACCCAGACTACCTGCAGGAATACAGCACAAAATATTTTTATAAACAGAATGGACGGATCCGCCCC
ATTGTGGCAGAGAATCCTGAGTACCTCTCGGAGTTCTCGCTGAAGCCTGGCACTATGCTGCCCCCTCCGC
CCTACAGACACCGGAATACTGTGGTG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR225933 representing NM_010154
Red=Cloning site Green=Tags(s)

MKLATGLWVWGSLLMAAGTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEH
NRDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGNFGLQELGLKNLT
EILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVSTNGSSGCGRCHKSCTGRCWGPTENHCQTLTR
TVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFACMNFNDSGACVTQCPQTFVYNPTTFQLEHNFN
AKYTYGAFCVKKCPHNFVVDSSSCVRACPSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDS
SNIDKFINCTKINGNLIFLVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQSWPPNMTDFSVFSNL
VTIGGRVLYSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTINQRIVIRDN
RRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDGEFREFENGSICVECDSQCE
KMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDGLQGANSFIFKYADQDRECHPCHPNCTQGCNGPTS
HDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIMALTFAVYVRRKSIKKKRALRRFLETELVEPLTP
SGTAPNQAQLRILKETELKRVKVLGSGAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEAL
IMASMDHPHLVRLLGVCLSPTIQLVTQLMPHGCLLDYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLV
HRDLAARNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSYGVTI
WELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYMVMVKCWMIDADSRPKFKELAAEFSRMARD
PQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQAFNIPPPIYTSRTRIDSNRNQFVY
QDGGFATQQGMPMPYRATTSTIPEAPVAQGATAEMFDDSCCNGTLRKPVAPHVQEDSSTQRYSADPTVFA
PERNPRGELDEEGYMTPMHDKPKQEYLNPVEENPFVSRRKNGDLQALDNPEYHSASSGPPKAEDEYVNEP
LYLNTFANALGSAEYMKNSVLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYLQEYSTKYFYKQNGRIRP
IVAENPEYLSEFSLKPGTMLPPPPYRHRNTVV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010154
ORF Size 3876 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010154.1, NM_010154.2, NP_034284
RefSeq Size 4257
RefSeq ORF 3879
Locus ID 13869
Cytogenetics 1 C3|1 33.8 cM
MW 145.7 kDa

Citations (1)

Other Versions

Other products for "Erbb4"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
10 percent off protein banner ad
68 Mouse Clones
20%off selected tag antibodies