Marveld2 (NM_178410) Mouse Tagged ORF Clone

  • TrueORF®
    TrueORF®

    Expression-ready ORF plasmid with C-terminal tag(s)

    Click here to learn more.

SKU
MR225365
Marveld2 (Myc-DDK-tagged) - Mouse MARVEL (membrane-associating) domain containing 2 (Marveld2), transcript variant 2
$330.00
3 Weeks*
Specifications
Product Data
Type Mouse Tagged ORF Clone
Target Symbol Marveld2
Synonyms BC003296; MARVD2; Mrvldc2; Tric; Trica; Tricb; Tricc
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
ORF Nucleotide Sequence
>MR225365 representing NM_178410
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCGGCGACGGGACGCCGAGCCCGCGGGGTGGGCCTTTCGCCCTGGGCACACATCCCCGGAGCCGCCTC
CCTCCCGCGGCCAGGCTGAAGCGGGAGCACGCGGGCGCGCCGGGCTCCGGGGGCGGCGTGGGCGGGTTTC
GCTGCAGCGACAGGTGCGGCCGGCTGGACCGCCGCCGTCCTTCCGGGCGCCTGGTGGCGCCGCCCTCGCC
ACTTTCCCGGCTGGCCTGACCGAGACAACGGCCACCTTGGGGCGGAAGCCAGAGTGGATTTTCCAGAGAA
GAAAGCGAAGGCGGGACACGCACCGGATAAATGACCCGTCGTTGTCATCGAAAAGGAAAATGTGTGAAGC
GGCCATCAGTGATCGACAGAGGGATCAGGAAGTTAATGTCAAAGACTTGAGAACAACAACTAAAATGACT
CCTGAGCTGTTGAGTGGGCACATCCCTCCCGGCCACATTCCGAAGCCTATCGTGATGCCTGACTACGTGG
CAAAATATCCTGTGATTCAGACAGATGACGATCGAGAACGCTATAAGGCTGTGTTCCAAGACCAGTTTTC
AGAGTACAAAGAGCTGTCTGCGGAAGTGCAGGCCATCCTGAGGAAGTTTGACGAGCTGGACACAGTGATG
AGCAGGCTCCCACATCATTCTGAAAACCGCCAGGAACACGAGAGAATTTCAAGAATTCATGAAGAGTTTA
GGAAAAAGAAGAATGACCCTTCGTTTCTGGAAAAAAAGGAGCGTTGCGATTACCTCAAGAACAAACTCTC
TCACATAAAGCAAAGAATTCAAGAATACGATAAAGTGATGAATTGGGATACGCAAGGTTATCCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR225365 representing NM_178410
Red=Cloning site Green=Tags(s)

MRRRDAEPAGWAFRPGHTSPEPPPSRGQAEAGARGRAGLRGRRGRVSLQRQVRPAGPPPSFRAPGGAALA
TFPAGLTETTATLGRKPEWIFQRRKRRRDTHRINDPSLSSKRKMCEAAISDRQRDQEVNVKDLRTTTKMT
PELLSGHIPPGHIPKPIVMPDYVAKYPVIQTDDDRERYKAVFQDQFSEYKELSAEVQAILRKFDELDTVM
SRLPHHSENRQEHERISRIHEEFRKKKNDPSFLEKKERCDYLKNKLSHIKQRIQEYDKVMNWDTQGYP

myc-FLAG tag
Restriction Sites SgfI-MluI Cloning Scheme for this gene Plasmid Map
ACCN NM_178410
ORF Size 834 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution Method 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Shipping Ambient
Reference Data
RefSeq NM_178410.3, NP_848497.2
RefSeq Size 2203 bp
RefSeq ORF 837 bp
Locus ID 218518
Cytogenetics 13 D1
MW 32.6 kDa
Summary Plays a role in the formation of tricellular tight junctions and of epithelial barriers (PubMed:16365161). Required for normal hearing via its role in the separation of the endolymphatic and perilymphatic spaces of the organ of Corti in the inner ear, and for normal survival of hair cells in the organ of Corti (PubMed:26677943).[UniProtKB/Swiss-Prot Function]
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

SKU Description Size Price
MC202301 Marveld2 (untagged) - Mouse MARVEL (membrane-associating) domain containing 2 (Marveld2), transcript variant 2, (10ug) 10 ug
$150.00
MG225365 Marveld2 (tGFP-tagged) - Mouse MARVEL (membrane-associating) domain containing 2 (Marveld2) transcript variant 2, (10ug) 10 ug
$530.00
MR225365L3 Lenti ORF clone of Marveld2 (Myc-DDK-tagged) - Mouse MARVEL (membrane-associating) domain containing 2 (Marveld2), transcript variant 2 10 ug
$630.00
MR225365L4 Lenti ORF clone of Marveld2 (mGFP-tagged) - Mouse MARVEL (membrane-associating) domain containing 2 (Marveld2), transcript variant 2 10 ug
$630.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.