H2 (NM_010382) Mouse Tagged ORF Clone

USD 330.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name H2 (NM_010382) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol H2
Synonyms Eb; H-2Eb; H2Eb; Ia-4; Ia4
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR224629 representing NM_010382
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGTGGCTCCCCAGAGTTCCCTGTGTGGCAGCTGTGATCCTGTTGCTGACAGTGCTGAGCCCTCCAG
TGGCTTTGGTCAGAGACTCCAGACCATGGTTTTTGGAATACTGTAAATCTGAGTGTCATTTCTACAACGG
GACGCAGCGCGTGCGGCTTCTGGAAAGATACTTCTACAACCTGGAGGAGAACCTGCGCTTCGACAGCGAC
GTGGGCGAGTTCCGCGCGGTGACCGAGCTGGGGCGGCCAGACGCCGAGAACTGGAACAGCCAGCCGGAGT
TCCTGGAGCAAAAGCGGGCCGAGGTGGACACGGTGTGCAGACACAACTATGAGATCTCGGATAAATTCCT
TGTGCGGCGGAGAGTTGAGCCTACGGTGACTGTGTACCCCACAAAGACACAGCCCCTGGAACACCACAAC
CTCCTGGTCTGCTCTGTGAGTGACTTCTACCCTGGCAACATTGAAGTCAGATGGTTCCGGAATGGCAAGG
AGGAGAAAACAGGAATTGTGTCCACGGGCCTGGTCCGAAATGGAGACTGGACCTTCCAGACACTGGTGAT
GCTGGAGACGGTTCCTCAGAGTGGAGAGGTTTACACCTGCCAGGTGGAGCATCCCAGCCTGACCGACCCT
GTCACGGTCGAGTGGAAAGCACAATCCACATCTGCACAGAACAAGATGTTGAGTGGAGTTGGGGGCTTCG
TGCTGGGCCTGCTCTTCCTGGGAGCGGGGCTGTTCATCTACTTCAGGAACCAGAAAGGACAGTCTGGACT
TCAGCCAACAGGACTCCTGAGC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR224629 representing NM_010382
Red=Cloning site Green=Tags(s)

MVWLPRVPCVAAVILLLTVLSPPVALVRDSRPWFLEYCKSECHFYNGTQRVRLLERYFYNLEENLRFDSD
VGEFRAVTELGRPDAENWNSQPEFLEQKRAEVDTVCRHNYEISDKFLVRRRVEPTVTVYPTKTQPLEHHN
LLVCSVSDFYPGNIEVRWFRNGKEEKTGIVSTGLVRNGDWTFQTLVMLETVPQSGEVYTCQVEHPSLTDP
VTVEWKAQSTSAQNKMLSGVGGFVLGLLFLGAGLFIYFRNQKGQSGLQPTGLLS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010382
ORF Size 792 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010382.2, NP_034512.2
RefSeq Size 1669
RefSeq ORF 795
Locus ID 14969
Cytogenetics 17 17.98 cM
MW 30.6 kDa

Other Versions

Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 299.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 550.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
68 Mouse Clones