Ebf2 (NM_010095) Mouse Tagged ORF Clone

CAT#: MR224591

Ebf2 (Myc-DDK-tagged) - Mouse early B-cell factor 2 (Ebf2)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 732.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Ebf2 (NM_010095) Mouse Tagged ORF Clone
Symbol Ebf2
Synonyms D14Ggc1e; EBF-2; Mmot1; O/E-3; OE-3
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR224591 representing NM_010095
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTTTGGGATTCAAGATACGCTAGGAAGAGGACCAGCTCTGAAAGACAAGTCGCTGGGTGCCGAGATGG
ATTCGGTCAGGTCCTGGGTCCGGAATGTCGGCGTGGTGGACGCCAATGTCGCGGCTCAGAGCGGAGTTGC
TCTGTCCCGGGCCCATTTTGAAAAGCAACCTCCTTCAAACTTGAGGAAATCCAACTTCTTTCATTTTGTC
CTGGCGCTCTACGACAGGCAGGGACAGCCGGTGGAGATTGAGCGCACAGCCTTCGTGGACTTTGTGGAGA
ATGACAAAGAGCAAGGCAATGAGAAGACCAACAATGGTACTCACTACAAGTTACAGCTCCTTTACAGCAA
CGGTGTCCGCACGGAGCAGGACCTGTATGTCAGGCTCATCGACTCTGTCACCAAACAGCCCATAGCCTAT
GAGGGACAGAATAAGAATCCCGAAATGTGCAGAGTTCTGCTGACACACGAGGTGATGTGCAGTCGATGCT
GTGAGAAGAAGAGCTGCGGGAACCGGAACGAGACCCCTTCAGACCCGGTCATCATCGACAGATTCTTTTT
AAAATTTTTCCTGAAGTGCAATCAGAATTGTTTGAAAACAGCGGGAAACCCAAGGGACATGAGGCGGTTC
CAGGTCGTGTTGTCCACAACAGTAAATGTGGATGGACATGTGCTGGCTGTTTCTGACAACATGTTTGTTC
ATAACAATTCTAAGCATGGAAGGAGAGCAAGAAGGCTTGACCCATCTGAAGCTACACCCTGCATCAAAGC
CATCAGCCCAAGTGAAGGCTGGACCACAGGAGGGGCCATGGTCATCATCATTGGTGACAACTTTTTTGAT
GGTCTCCAGGTTGTGTTTGGTACCATGCTTGTATGGAGTGAGCTCATAACCCCTCATGCCATCAGAGTAC
AGACCCCTCCCCGGCATATCCCTGGAGTTGTGGAAGTGACACTATCTTATAAATCCAAACAGTTCTGCAA
AGGAGCCCCGGGCAGGTTCATCTACACAGCCTTAAATGAACCCACCATAGACTATGGCTTCCAAAGATTG
CAGAAAGTCATCCCAAGGCACCCAGGTGACCCTGAGAGGCTAGCTAAGGAAATGCTGTTGAAAAGAGCTG
CGGACCTGGTGGAAGCCCTCTACGGCACACCACACAATAATCAGGACATCATTTTAAAGCGTGCTGCAGA
CATTGCTGAAGCCCTGTACAGTGTCCCCAGGAACCCCAGCCAGATTCCAGCTCTTTCCAGCTCCCCAGCT
CACAGCGGTATGATGGGTATCAACTCTTACGGCAGCCAGCTCGGCGTCAGCATTTCAGAGTCCACACAAG
GAAATAACCAAGGATACATCCGCAACACAAGCAGCATCTCCCCGCGGGGATACTCCTCCAGCTCCACGCC
TCAGCAATCTAATTACAGCACCTCCAGCAACAGCATGAACGGCTACAGCAATGTTCCTATGGCCAACCTG
GGTGTGCCAGGATCCCCGGGATTTCTGAATGGCTCACCCACGGGCTCCCCATATGGAATCATGTCTTCAA
GCCCCACCGTGGGATCCTCCAGCACGTCCTCCATCCTCCCGTTCTCCTCTTCAGTTTTTCCTGCTGTCAA
ACAGAAGAGTGCCTTTGCCCCTGTCATCAGGCCCCAAGGCTCCCCATCGCCTGCCTGCTCCAGCGGCAAT
GGGAACGGATTCAGAGCCATGACAGGACTTGTTGTTCCCCCGATG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR224591 representing NM_010095
Red=Cloning site Green=Tags(s)

MFGIQDTLGRGPALKDKSLGAEMDSVRSWVRNVGVVDANVAAQSGVALSRAHFEKQPPSNLRKSNFFHFV
LALYDRQGQPVEIERTAFVDFVENDKEQGNEKTNNGTHYKLQLLYSNGVRTEQDLYVRLIDSVTKQPIAY
EGQNKNPEMCRVLLTHEVMCSRCCEKKSCGNRNETPSDPVIIDRFFLKFFLKCNQNCLKTAGNPRDMRRF
QVVLSTTVNVDGHVLAVSDNMFVHNNSKHGRRARRLDPSEATPCIKAISPSEGWTTGGAMVIIIGDNFFD
GLQVVFGTMLVWSELITPHAIRVQTPPRHIPGVVEVTLSYKSKQFCKGAPGRFIYTALNEPTIDYGFQRL
QKVIPRHPGDPERLAKEMLLKRAADLVEALYGTPHNNQDIILKRAADIAEALYSVPRNPSQIPALSSSPA
HSGMMGINSYGSQLGVSISESTQGNNQGYIRNTSSISPRGYSSSSTPQQSNYSTSSNSMNGYSNVPMANL
GVPGSPGFLNGSPTGSPYGIMSSSPTVGSSSTSSILPFSSSVFPAVKQKSAFAPVIRPQGSPSPACSSGN
GNGFRAMTGLVVPPM

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_010095
ORF Size 1725 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_010095.1, NM_010095.2, NM_010095.3, NM_010095.4, NM_010095.5, NM_010095.6, NP_034225
RefSeq Size 5527
RefSeq ORF 1728
Locus ID 13592
Cytogenetics 14|14 D1
MW 63.1 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations