Gpm6b (NM_023122) Mouse Tagged ORF Clone

CAT#: MR224395

Gpm6b (Myc-DDK-tagged) - Mouse glycoprotein m6b (Gpm6b), transcript variant 5

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Gpm6b (NM_023122) Mouse Tagged ORF Clone
Symbol Gpm6b
Synonyms AI593561; Gpm6; M6B
Vector pCMV6-Entry
Sequence Data
>MR224395 representing NM_023122
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGTTGCTTCGAATGCTGCATCAAGTGTCTGGGAGGAGTTCCCTATGCCTCCCTGGTGGCCACCATCC
TATGTTTCTCTGGAGTGGCCTTGTTCTGTGGCTGTGGGCATGTGGCTCTTGCAGGCACCGTGGCAATTCT
TGAGCAACACTTCTCCACCAACACCAGTGACCATGCCTTGCTGAGTGAAGTGATCCAACTGATGCAGTAT
GTTATCTATGGAATCGCCTCCTTTTTCTTCCTGTATGGCATCATTCTTCTGGCAGAAGGCTTCTACACCA
CAAGTGCAGTGAAAGAGCTGCACGGTGAGTTTAAAACAACTGCCTGTGGCCGATGCATCAGTGGAATGTT
CGTGTTCCTCACCTATGTGCTGGGAGTGGCCTGGCTGGGTGTGTTCGGCTTTTCCGCAGTGCCAGTGTTT
ATGTTCTACAACATCTGGTCAACCTGTGAAGTCATCAAGTCCCCACAAAGCAACGGGACCTCGGGTGTGG
AGCAGATCTGTGTGGATGTCCGGCAATATGGTATCATTCCTTGGAATGCTTTCCCAGGCAAAATCTGTGG
CTCGGCCTTGGAGAACATCTGCAACACGAATGAGTTCTACATGTCCTATCACCTGTTCATTGTGGCTTGT
GCTGGAGCTGGTGCCACCGTCATTGCCCTGATCCACTTCCTCATGATACTGTCTTCTAACTGGGCTTACT
TAAAGGATGCAAGCAAAATGCAGGCTTACCAGGATATCAAAGCAAAGGAAGAGCAGGAACTGCAAGATAT
CCAGTCTCGCTCAAAAGAACAACTCAATTCTTACACT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR224395 representing NM_023122
Red=Cloning site Green=Tags(s)

MGCFECCIKCLGGVPYASLVATILCFSGVALFCGCGHVALAGTVAILEQHFSTNTSDHALLSEVIQLMQY
VIYGIASFFFLYGIILLAEGFYTTSAVKELHGEFKTTACGRCISGMFVFLTYVLGVAWLGVFGFSAVPVF
MFYNIWSTCEVIKSPQSNGTSGVEQICVDVRQYGIIPWNAFPGKICGSALENICNTNEFYMSYHLFIVAC
AGAGATVIALIHFLMILSSNWAYLKDASKMQAYQDIKAKEEQELQDIQSRSKEQLNSYT

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_023122
ORF Size 807 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_023122.1, NM_023122.2, NM_023122.3, NP_075611
RefSeq Size 2932
RefSeq ORF 810
Locus ID 14758
Cytogenetics X|X F5
MW 29.9 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)