Orc4 (NM_001177313) Mouse Tagged ORF Clone

CAT#: MR224351

Reviews ()
Write a review
  • TrueORF®

Orc4 (Myc-DDK-tagged) - Mouse origin recognition complex, subunit 4 (Orc4), transcript variant 2



  "NM_001177313" in other vectors (3)

Interest in protein/lysate? Submit request here!

USD 206.00


Availability*
2 Weeks

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Orc4 (NM_001177313) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Orc4
Synonyms mMmORC4; Orc4l; Orc4P
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR224351 representing NM_001177313
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAGCAGTCGTAAAACCAAGAGTAATGCACATGCAGAGTGTCTTTCACAGGTACAAAGAATTTTACGTG
AAAGATTTTGTCATCATAGTCCACATAGCAACCTCTTTGGAGTGCAAGTACAATACAAGCATTTGATTGA
GCTACTCAAAAGAACTGCTATCTATGGAGAAAGCAATTCTGTACTCATTGTTGGACCACGAGGATCAGGA
AAGACCACATTATTAAATCATGCTTTGAAAGAACTCATGGAAATAGAAGTGAGTGAAAATGTGATACAAG
TTCACTTAAATGGACTCCTGCAGACAAATGAAAAAATTGCTCTGAAAGAGATCACAAGACAATTAAATCT
AGACAATGTAGTTGAAGATAAAGTTTTTGGTATGCTGGTGTGCCTTGAAGTCTCAAAGTACCGA


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR224351 representing NM_001177313
Red=Cloning site Green=Tags(s)

MSSRKTKSNAHAECLSQVQRILRERFCHHSPHSNLFGVQVQYKHLIELLKRTAIYGESNSVLIVGPRGSG
KTTLLNHALKELMEIEVSENVIQVHLNGLLQTNEKIALKEITRQLNLDNVVEDKVFGMLVCLEVSKYR

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_001177313
ORF Size 414 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_001177313.1, NP_001170784.1
RefSeq Size 1397 bp
RefSeq ORF 417 bp
Locus ID 26428
Cytogenetics 2 C1.1
MW 16.2 kDa
Gene Summary Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3 (By similarity). Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Orc4"
Frequently bought together (2)
Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 100 ul

USD 350.00


pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools