Fndc4 (NM_022424) Mouse Tagged ORF Clone

CAT#: MR223815

Fndc4 (Myc-DDK-tagged) - Mouse fibronectin type III domain containing 4 (Fndc4)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 149.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Fndc4 (NM_022424) Mouse Tagged ORF Clone
Symbol Fndc4
Synonyms 2810430J06Rik; 6330410H20Rik; AB030187; AI838506; AW487863; Fnmp1; FRCP1
Vector pCMV6-Entry
Sequence Data
>MR223815 representing NM_022424
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCTCTGGCCCCTCCAGCGAACTCGGTGGAAACCATGGCTTCTTTGATGCCTCTTTCCCCATATCTGA
GTCCCACGGTCCTCCTGCTGGTCAGCTGTGACCTGGGTTTTGTGCGAGCAGACCGACCTCCCTCTCCTGT
GAATGTGACGGTCACTCATCTCAGAGCCAACTCAGCCACTGTGTCCTGGGACGTTCCAGAAGGCAACATC
GTCATTGGCTACTCCATTTCCCAGCAACGACAGAATGGCCCGGGGCAGCGTGTAATCAGAGAAGTGAACA
CCACCACCAGGGCCTGCGCTCTCTGGGGCCTGGCTGAAGACAGTGACTACACAGTGCAGGTTAGGAGCAT
CGGCCTCCGGGGAGAGAGCCCTCCAGGGCCCCGTGTGCACTTCCGCACGCTCAAGGGTTCTGACAGGCTG
CCCTCCAACAGCTCCAGTCCAGGTGATATTACAGTGGAGGGTCTGGATGGAGAGCGGCCATTGCAGACAG
GGGAAGTCGTCATCATTGTAGTGGTATTGCTCATGTGGGCTGCTGTAATCGGGCTATTCTGCCGTCAGTA
TGACATCATCAAGGACAACGACTCCAACAACAACCCCAAGGAGAAGGGGAAGGGGCCTGAACAGAGTCCT
CAGGGAAGGCCAGTGGGGACAACAAGACAGAAAAAGTCTCCATCAATCAACACCATTGATGTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223815 representing NM_022424
Red=Cloning site Green=Tags(s)

MPLAPPANSVETMASLMPLSPYLSPTVLLLVSCDLGFVRADRPPSPVNVTVTHLRANSATVSWDVPEGNI
VIGYSISQQRQNGPGQRVIREVNTTTRACALWGLAEDSDYTVQVRSIGLRGESPPGPRVHFRTLKGSDRL
PSNSSSPGDITVEGLDGERPLQTGEVVIIVVVLLMWAAVIGLFCRQYDIIKDNDSNNNPKEKGKGPEQSP
QGRPVGTTRQKKSPSINTIDV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_022424
ORF Size 693 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_022424.3, NM_022424.4, NM_022424.5, NP_071869
RefSeq Size 2270
RefSeq ORF 696
Locus ID 64339
Cytogenetics 5|5 B1
MW 25.4 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)