Kctd20 (NM_025888) Mouse Tagged ORF Clone

CAT#: MR223503

Reviews ()
Write a review
  • TrueORF®

Kctd20 (Myc-DDK-tagged) - Mouse potassium channel tetramerisation domain containing 20 (Kctd20)



  "NM_025888" in other vectors (4)

Interest in protein/lysate? Submit request here!

Get anti-DDK tag antibody at $68 with code “DDK”. View details.

USD 309.00


Availability*
In Stock

Size
    • 10 ug


Product images

Specifications

Product Data
Product Name Kctd20 (NM_025888) Mouse Tagged ORF Clone
Type Mouse Tagged ORF Clone
Tag Myc-DDK
Symbol Kctd20
Synonyms 2410004N11Rik; AI451943; AW541186; D17Ertd562e
Vector pCMV6-Entry
E. coli Selection Kanamycin (25 ug/mL)
Cell Selection Neomycin
Sequence Data
>MR223503 representing NM_025888
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGAATGTTCACCAGGGCAGTGATGGCGACTGGTCATTGCAGCCAGAGCTCAGCTGCCTAGGAGATGAGG
CCTTAGCTGCCACTCAAGAGAAAGAAGGCAGCAGCTTGGTGTCCTCTGGTCTGCATAGTGTCACTTATCC
CCTAGCTGCCAGGAGTGAAGACCTTGCACTTGACTATGCCTCTCAGCCAGCAAGCCTTCCGCATCCTCAC
ATAATGCCACTTCCTGAAGACAACAAGGGCTCATGCTTCCAGAGTGGGAGCAAACGGAGCCACGAGCCCT
TCATTGTGCCAGAGAGATTTGGAAACAGCGGCTTAGGTTTTGGAGGTGGCGCTCACTCTCAAGCCCCAGA
GAAGGTGACACTTCTTGTGGATGGCACTCGTTTTGTGGTAAATCCTCAGATTTTCACTGCTCATCCGGAT
ACCATGTTGGGAAGGATGTTTGGGCCGGGAAGAGAATACAACTTCACAAGGCCCAATGAAAAGGGGGAGT
ATGTGATCGCGGAGGGGATCAGCGCCACCGTGTTCCGCACAGTCCTGGATTATTACAAAACTGGCATCAT
CAACTGTCCAGATGGCATCTCTATCCCAGACCTCAGAGACACGTGTGACTATCTCTGCATTAACTTCGAC
TTCAACACTATCCGATGTCAGGATCTGAGTGCTCTACTGCACGAGCTCTCCAACGATGGTGCCCACAAGC
AGTTTGACCACTACCTCGAGGAACTGATTCTGCCCATCATGGTGGGCTGTGCCAAGAAAGGCGAGCGAGA
GTGTCACATTGTCGTGCTGACAGACGAGGACTCTGTGGACTGGGATGAAGACCACCCCCCACCCATGGGG
GAAGAGTATTCCCAAATTCTTTACAGCTCCAAGCTCTACAGATTCTTCAAATATATCGAGAATAGAGATG
TTGCTAAAACTGTGTTAAAGGAACGAGGCCTGAAGAACATCCGCATTGGAATTGAAGGTTACCCTACCTG
TAAAGAGAAGATCAAGAGGAGACCTGGCGGGCGGTCTGAAGTCATCTACAATTATGTGCAGCGCCCTTTT
ATCCAGATGTCATGGGAAAAAGAGGAAGGAAAGAGTCGCCATGTGGATTTCCAGTGCGTTCGCAGCAAAT
CCCTCACTAATTTGGTGGCTGCTGGAGAGGATGTCTTAGAAGACCAGGAGATAATAATGCATCACCCACC
ACAAGTAGATGAACTTGACCGCTTAAATGCTCCACTCTCTCAGATGGCTCCGAATGACTTTCAAGAT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223503 representing NM_025888
Red=Cloning site Green=Tags(s)

MNVHQGSDGDWSLQPELSCLGDEALAATQEKEGSSLVSSGLHSVTYPLAARSEDLALDYASQPASLPHPH
IMPLPEDNKGSCFQSGSKRSHEPFIVPERFGNSGLGFGGGAHSQAPEKVTLLVDGTRFVVNPQIFTAHPD
TMLGRMFGPGREYNFTRPNEKGEYVIAEGISATVFRTVLDYYKTGIINCPDGISIPDLRDTCDYLCINFD
FNTIRCQDLSALLHELSNDGAHKQFDHYLEELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMG
EEYSQILYSSKLYRFFKYIENRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPF
IQMSWEKEEGKSRHVDFQCVRSKSLTNLVAAGEDVLEDQEIIMHHPPQVDELDRLNAPLSQMAPNDFQD

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_025888
ORF Size 1257 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_025888.6
RefSeq Size 2400 bp
RefSeq ORF 1260 bp
Locus ID 66989
Cytogenetics 17 15.03 cM
MW 47.5 kDa
Gene Summary Promotes the phosphorylation of AKT family members.[UniProtKB/Swiss-Prot Function]

Other Versions

Other products for "Kctd20"
Frequently bought together (2)
pCMV6-Entry, mammalian vector with C-terminal Myc- DDK Tag, 10ug
    • 10 ug

USD 570.00


Clone OTI4C5, Anti-DDK (FLAG) monoclonal antibody
    • 30 ul

USD 150.00

Customer Reviews 
Loading...
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Molbio tools