Casr (NM_013803) Mouse Tagged ORF Clone

CAT#: MR223303

Casr (Myc-DDK-tagged) - Mouse calcium-sensing receptor (Casr)

  • TrueORF®

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

USD 48.00

USD 1,381.00


Availability*
In Stock

Size
    • 10 ug

Cited in 1 publication.

Product images

Specifications

Product Data
Product Name Casr (NM_013803) Mouse Tagged ORF Clone
Symbol Casr
Synonyms CaR; Gprc2a
Vector pCMV6-Entry
Sequence Data
>MR223303 representing NM_013803
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCATGGTTTGGCTACTGTTTGGCCCTCCTGGCTCTCACCTGGCACTCCTCTGCCTATGGGCCTGACC
AGCGAGCCCAAAAGAAGGGGGACATTATCCTAGGAGGTCTCTTTCCTATCCATTTTGGAGTAGCAGCCAA
AGATCAAGATCTGAAGTCAAGACCAGAGTCTGTGGAGTGCATCAGGTATAACTTCCGTGGATTCCGATGG
TTACAAGCCATGATCTTTGCCATAGAGGAGATAAACAGCAGCCCCGCCCTTCTTCCCAACATGACTCTGG
GATATAGGATATTCGACACCTGTAACACCGTCTCCAAGGCTCTGGAGGCCACCTTGAGTTTTGTTGCCCA
GAACAAAATCGATTCTCTGAACCTGGATGAGTTCTGCAACTGCTCCGAGCACATCCCTTCAACCATCGCA
GTGGTGGGAGCAACCGGCTCCGGTGTCTCCACAGCGGTAGCCAACCTGCTGGGACTTTTCTATATCCCCC
AGGTGAGCTACGCCTCCTCTAGCAGGCTTCTCAGCAATAAGAACCAGTTCAAGTCCTTCCTCCGCACCAT
TCCCAACGACGAACACCAGGCCACCGCGATGGCTGACATTATCGAGTATTTCCGTTGGAACTGGGTGGGC
ACAATTGCAGCCGACGACGACTATGGCAGGCCTGGCATTGAGAAGTTCCGAGAGGAAGCCGAGGAGAGGG
ACATCTGCATTGACTTCAGCGAGCTCATCTCCCAGTACTCTGATGAGGAAGAGATCCAGCAGGTGGTGGA
AGTGATCCAGAACTCTACAGCCAAGGTCATTGTCGTTTTCTCCAGCGGCCCAGACCTAGAACCTCTCATC
AAGGAGATTGTGCGCCGTAACATCACAGGCAGGATCTGGCTGGCCAGCGAGGCCTGGGCCAGTTCCTCCC
TGATTGCTATGCCTGAGTACTTCCATGTAGTCGGGGGTACCATTGGGTTCGGTCTGAAGGCTGGGCAGAT
TCCAGGCTTCCGAGAATTCCTACAGAAAGTCCATCCCAGGAAGTCTGTCCACAATGGTTTTGCCAAAGAG
TTTTGGGAAGAAACATTTAATTGCCACCTGCAAGACGGCGCAAAAGGACCTTTACCCGTGGACACCTTCG
TGAGAAGTCACGAGGAAGGCGGCAACAGGTTACTCAATAGCTCCACTGCCTTCCGACCCCTCTGCACGGG
GGATGAAAACATCAATAGTGTCGAGACCCCTTACATGGACTACGAACATTTACGGATATCCTACAACGTG
TACTTAGCCGTCTACTCCATTGCGCACGCCCTGCAAGATATATACACCTGCTTACCCGGAAGAGGGCTTT
TCACCAACGGGTCCTGTGCAGACATCAAGAAGGTTGAGGCCTGGCAGGTCCTGAAACACCTACGGCACCT
GAATTTCACCAACAACATGGGGGAGCAGGTGACCTTCGATGAGTGCGGTGACCTGGTGGGGAACTACTCC
ATCATCAACTGGCACCTCTCCCCAGAGGACGGCTCCATTGTGTTCAAGGAAGTTGGGTACTACAATGTGT
ATGCCAAGAAGGGAGAAAGACTGTTCATCAATGAGGGGAAGATCTTGTGGAGTGGGTTCTCCAGAGAGGT
GCCCTTCTCCAACTGCAGCCGGGACTGTCAGGCAGGGACCAGGAAGGGCATCATTGAGGGAGAGCCCACC
TGCTGTTTTGAGTGTGTGGAGTGTCCTGACGGCGAGTACAGTGGTGAGACAGATGCGAGTGCCTGTGACA
AGTGCCCGGATGACTTCTGGTCCAATGAGAACCACACTTCCTGCATTGCCAAGGAGATTGAGTTCCTGGC
GTGGACTGAGCCCTTTGGAATCGCTCTCACTCTCTTTGCGGTGCTGGGCATTTTCCTGACCGCCTTTGTG
CTGGGCGTCTTCATCAAGTTCCGAAACACGCCCATTGTCAAGGCCACCAACCGAGAGCTGTCCTACCTCC
TGCTCTTCTCACTCCTCTGCTGCTTCTCCAGCTCCCTGTTCTTCATTGGGGAGCCCCAGGACTGGACCTG
CCGCCTGCGACAGCCCGCCTTCGGCATCAGCTTCGTGCTTTGTATCTCGTGCATCTTGGTGAAGACCAAT
CGAGTCCTCCTGGTATTTGAGGCCAAAATACCCACCAGCTTCCACCGGAAGTGGTGGGGACTCAACCTGC
AGTTCCTGCTGGTTTTCCTCTGCACCTTCATGCAGATTGTCATCTGCATCATCTGGCTCTACACGGCACC
CCCCTCCAGCTACCGCAACCACGAGCTGGAAGACGAAATCATCTTCATCACGTGCCATGAGGGCTCACTC
ATGGCGCTCGGCTCCCTGATCGGCTACACCTGCCTCCTGGCTGCCATCTGCTTCTTCTTTGCCTTCAAGT
CTCGGAAGCTGCCAGAGAACTTCAACGAAGCCAAGTTCATTACCTTCAGCATGCTCATCTTCTTCATCGT
CTGGATCTCCTTCATTCCAGCCTATGCCAGCACCTACGGCAAGTTTGTCTCTGCCGTGGAGGTGATCGCC
ATCCTGGCAGCCAGCTTTGGCTTGCTAGCCTGCATCTTCTTCAACAAGGTCTACATCATCCTCTTCAAGC
CTTCACGGAACACCATCGAGGAGGTGCGCTCCAGCACTGCGGCTCATGCTTTCAAAGTGGCAGCCCGCGC
CACTCTACGCCGCCCCAACATCTCCCGGAAGCGGTCCAGCAGCCTCGGAGGCTCCACTGGGTCGATTCCC
TCCTCCTCCATCAGCAGCAAAAGCAACAGCGAAGACCGGTTCCCACAGCCGGAGAGGCAGAAGCAACAGC
AACCACTGGCCCTGACCCAGCAAGAACAGCAGCAGCAGCCCCTGACTCTCCAGCCGCAGCAACAGCAACA
GCCACAGCAGCCGAGATGCAAACAGAAGGTCATCTTCGGCAGTGGCACAGTCACCTTCTCTCTGAGCTTT
GATGAGCCTCAGAAGAATGCTATGGCCCACAGGAACTCCATGCGCCAGAACTCCCTGGAGGCCCAGAAGA
GCAATGACACTTTGAACAGACACCAGGCCCTGCTTCCCCTACAGTGTGCAGAGGCGGACTCAGAAATGAC
CATTCAGGAGACGGGCTTGCAAGGGCCAATGGTGGGGGACCACCAGCCAGAAATAGAAAGCCCAGATGAA
ATGTCCCCAGCTCTGGTCATGTCCACCTCTCGGAGCTTCGTCATCAGCGGTGGAGGTAGCTCTGTGACGG
AAAACATACTGCACTCC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR223303 representing NM_013803
Red=Cloning site Green=Tags(s)

MAWFGYCLALLALTWHSSAYGPDQRAQKKGDIILGGLFPIHFGVAAKDQDLKSRPESVECIRYNFRGFRW
LQAMIFAIEEINSSPALLPNMTLGYRIFDTCNTVSKALEATLSFVAQNKIDSLNLDEFCNCSEHIPSTIA
VVGATGSGVSTAVANLLGLFYIPQVSYASSSRLLSNKNQFKSFLRTIPNDEHQATAMADIIEYFRWNWVG
TIAADDDYGRPGIEKFREEAEERDICIDFSELISQYSDEEEIQQVVEVIQNSTAKVIVVFSSGPDLEPLI
KEIVRRNITGRIWLASEAWASSSLIAMPEYFHVVGGTIGFGLKAGQIPGFREFLQKVHPRKSVHNGFAKE
FWEETFNCHLQDGAKGPLPVDTFVRSHEEGGNRLLNSSTAFRPLCTGDENINSVETPYMDYEHLRISYNV
YLAVYSIAHALQDIYTCLPGRGLFTNGSCADIKKVEAWQVLKHLRHLNFTNNMGEQVTFDECGDLVGNYS
IINWHLSPEDGSIVFKEVGYYNVYAKKGERLFINEGKILWSGFSREVPFSNCSRDCQAGTRKGIIEGEPT
CCFECVECPDGEYSGETDASACDKCPDDFWSNENHTSCIAKEIEFLAWTEPFGIALTLFAVLGIFLTAFV
LGVFIKFRNTPIVKATNRELSYLLLFSLLCCFSSSLFFIGEPQDWTCRLRQPAFGISFVLCISCILVKTN
RVLLVFEAKIPTSFHRKWWGLNLQFLLVFLCTFMQIVICIIWLYTAPPSSYRNHELEDEIIFITCHEGSL
MALGSLIGYTCLLAAICFFFAFKSRKLPENFNEAKFITFSMLIFFIVWISFIPAYASTYGKFVSAVEVIA
ILAASFGLLACIFFNKVYIILFKPSRNTIEEVRSSTAAHAFKVAARATLRRPNISRKRSSSLGGSTGSIP
SSSISSKSNSEDRFPQPERQKQQQPLALTQQEQQQQPLTLQPQQQQQPQQPRCKQKVIFGSGTVTFSLSF
DEPQKNAMAHRNSMRQNSLEAQKSNDTLNRHQALLPLQCAEADSEMTIQETGLQGPMVGDHQPEIESPDE
MSPALVMSTSRSFVISGGGSSVTENILHS

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_013803
ORF Size 3237 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_013803.1, NM_013803.2, NM_013803.3, NP_038831
RefSeq Size 4549
RefSeq ORF 3240
Locus ID 12374
Cytogenetics 16 B3|16 25.57 cM
MW 121.4 kDa
Gene Summary Senses changes in the extracellular concentration of calcium ions. The activity of this receptor is mediated by a G-protein that activates a phosphatidylinositol-calcium second messenger system. [UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)