Bcr (NM_001081412) Mouse Tagged ORF Clone

CAT#: MR222863

Bcr (Myc-DDK-tagged) - Mouse breakpoint cluster region (Bcr)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 1,628.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Bcr (NM_001081412) Mouse Tagged ORF Clone
Symbol Bcr
Synonyms 5133400C09Rik; AI561783; AI853148; mKIAA3017
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR222863 representing NM_001081412
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGGACTCGGTGGGCTTCGCCGAGGCGTGGAGGGCGCAGTTCCCGGACTCGGAGCCGCCGCGCATGG
AGCTGCGCTCGGTGGGTGACATCGAGCAGGAGCTGGAGCGCTGCAAGGCCTCCATTAGGCGCTTGGAGCA
GGAGGTGAACCAGGAGCGCTTCCGCATGATCTACCTGCAGACGCTGCTGGCCAAGGAGAAGAAGAGCTAC
GATCGGCAGCGCTGGGGCTTCCGCCGTGCAGCGCAGCCCCCCGACGGCGCCGCCGAGCCCCGAGCGTCCG
CCCCGCGCCCGCCGCCCGCGCCCGCCGACGGCGCAGACCCGGCGCCCGTCGAGGAGTCCGAGGCGCGGCC
GGACGGAGAGGGGTCACCGAGTAAGGGGCGGTCAGCGTCCGCCCGCAGGCCAGCGGCTGCTGCATCGGCG
GACCGGGACGACCGAGGGCCCCCCACCAGCGTGGCGGCGCTCAGATCCAACTTCGAGAAGATCCGCAAGG
GACCTGCCCAGCCCGGCTCTGCCGACGCCGAGAAGCCCTTCTACGTGAACGTCGAGTTCCACCACGAGCG
CGGCCTGGTGAAGGTCAACGACAAAGAGGTGTCCGACCGAATCAGTTCCCTGGGCAGCCAGGCCATGCAA
ATGGAGCGCAAGAAGTCCCAGCAGAGCGCCGGGCAGGGCCTGGGGGAAGCACCCAGACCCCATTACCGTG
GGCGCTCCTCGGAAAGCAGTTGCGGCCTTGACGGTGACTATGAGGATGCAGAGTTGAATCCCCGCTTCCT
GAAGGACAACCTAATAAATGCCAACGGCGGCAACAGGCCCCCTTGGCCGCCCCTGGAGTACCAACCCTAC
CAGAGCATCTATGTCGGAGGCATGATGGTGGAAGGGGAGGGCAAGAGCCCTCTCCTGCGAAGCCAGAGCA
CTTCAGAGCAGGAGAAACGCCTAACCTGGCCTCGCAGGTCCTACTCGCCTCGGAGTTTCGAGGACAGCGG
AGGTGGCTACACGCCGGACTGCAGCTCCAACGAGAACCTCACCTCCAGCGAGGAGGACTTTTCCTCTGGC
CAGTCCAGCCGCGTGTCACCAAGCCCCACCACCTACCGCATGTTCCGGGACAAGAGCCGCTCACCCTCGC
AGAATTCGCAGCAGTCCTTTGACAGCAGCAGCCCCCCGACGCCACAGTGCCAGAAGCGGCACCGGCAGTG
CCAGGTTGTGGTGTCTGAGGCTACCATCGTGGGTGTCCGCAAGACTGGGCAGATCTGGCCCAGTGATGGG
GACAGCACCTTTCAAGGGGAAGCAGATTCCTCGTTTGGAACACCACCTGGATATGGCTGTGCCGCAGACC
AGGCTGAGGAACAGCGCCGGCACCAGGACGGGCTGCCCTACATCGATGATTCACCTTCTTCCTCGCCACA
CCTCAGCAGCAAAGGCAGAGGCAGCCTGGCCTCAGGCGCCCTGGATCCCACCAAAGTGAGTGAGCTGGAT
CTGGAAAAGGGCCTGGAGATGAGAAAGTGGGTTTTGTCCGGAATCCTGGCCAGCGAGGAGACGTACCTGA
GCCATCTGGAGGCCCTGCTGCTGCCCATGAAGCCTCTGAAAGCCGCTGCCACCACCTCTCAGCCTGTGCT
GACCAGCCAGCAGATTGAGACCATTTTCTTCAAAGTGCCTGAGCTCTACGAGATCCACAAGGAGTTCTAC
GATGGGCTGTTCCCCCGAGTGCAGCAGTGGAGCCACCAGCAGCGTGTAGGGGACCTCTTCCAGAAGCTGG
CCAGCCAGCTGGGTGTGTACCGAGCCTTTGTGGATAACTACGGAGTGGCCATGGAAACTGCAGAGAAGTG
CTGTCAGGCCAACGCTCAGTTTGCAGAAATCTCTGAGAACCTGCGAGCCAGAAGCAACAAGGATGTCAAG
GACTCAACTACCAAGAACTCTTTGGAAACTCTGCTCTACAAACCTGTGGACCGGGTGACGAGGAGCACGC
TAGTCCTTCACGACTTGCTAAAACACACCCCGTCCAGCCATCCCGACCATTCCCTGCTGCAAGACGCCCT
CCGAATCTCTCAGAACTTCCTGTCCAGCATCAACGAGGAGATCACGCCCCGCCGACAGTCCATGACGGTG
AAAAAAGGAGAGCACCGGCAGCTGCTGAAGGACAGCTTTATGGTAGAGCTGGTGGAGGGGGCCCGCAAGC
TGCGTCACATCTTCCTGTTCACTGACCTGCTCCTCTGCACCAAGCTGAAGAAGCAAAGTGGAGGCAAAAC
CCAGCAATATGACTGTAAATGGTACATTCCGCTCACGGACCTCAGCTTCCAGATGGTGGATGAATTGGAG
GCACTACCCAACATCCCTCTGGTGCCAGATGAGGAACTGGATGCCTTGAAGATCAAAATCTCCCAAATCA
AGAGCGACATCCAACGAGAGAAGAGAGCAAATAAGGGCAGCAAGGTCATGGAGAGGCTGAGGAAGAAGCT
GTCAGAGCAGGAGTCACTGCTGCTGTTAATGTCTCCCAGCATGGCCTTCCGCGTTCACAGTCGCAACGGC
AAGAGTTACACGTTCCTTATTTCCTCTGACTATGAGCGAGCCGAGTGGAGAGAAAGCATCCGAGAGCAGC
AGAAGAAATGTTTCAAAAGTTTCTCTCTGACATCTGTGGAGCTACAAATGCTGACCAACTCATGTGTAAA
ACTTCAGACGGTTCACCACATTCCACTGACCATCAACAAAGAAGATGACGAGTCTCCTGGACTCTACGGC
TTCCTGCATGTCATCGTCCACTCAGCCACCGGCTTTAAGCAGAGCTCAAATCTCTACTGCACCCTGGAGG
TGGATTCCTTTGGATATTTTGTGAATAAAGCAAAGACTCGAGTCTACAGGGACACAACTGAGCCAAACTG
GAATGAGGAGTTTGAGATAGAGCTAGAAGGCTCCCAGACCCTGCGGATACTATGTTATGAAAAGTGTTAC
AACAAAATGAAGATGACGAAGGAAGATGGTGAGAGCGCAGACAAGCTCATGGGGAAAGGCCAGGTCCAGC
TGGACCCCCAAACCCTACAGGACAGAGACTGGCAGCGGACTGTCATCGACATGAATGGAATTGAAGTGAA
ACTCTCCGTCAAGTTCACGAGCAGGGAGTTCAGCCTGAAGAGAATGCCCTCCCGCAAACAGACAGGGGTC
TTCGGTGTCAAGATTGCTGTAGTCACAAAGAGAGAGAGGTCCAAGGTACCTTACATTGTGCGCCAGTGTG
TGGAAGAGATCGAGCGCCGGGGTATGGAGGAGGTGGGCATCTACCGAGTGTCTGGAGTGGCCACAGACAT
CCAGGCACTGAAGGCAGCCTTTGATGTCAATAACAAGGATGTGTCCGTGATGATGAGCGAGATGGACGTG
AACGCCATTGCCGGCACGCTGAAGCTCTACTTCCGTGAGCTGCCCGAGCCCCTCTTCACGGATGAGTTCT
ACCCTAACTTCGCAGAAGGCATTGCTCTTTCAGACCCCGTCGCAAAGGAGAGCTGCATGCTGAACCTGCT
GCTGTCCCTCCCAGAAGCCAACCTGCTCACCTTCCTCTTCCTCCTGGACCACCTGAAAAGGGTAGCTGAA
AAGGAGACGGTGAACAAGATGTCCCTGCACAACCTCGCCACGGTCTTTGGCCCCACACTGCTTCGGCCCT
CAGAGAAGGAAAGCAAGCTCCCTGCTAACCCCAGCCAGCCCATCACCATGACTGACAGCTGGTCCCTGGA
GGTCATGTCCCAGGTCCAAGTGTTGCTGTACTTCCTGCAGCTGGAGGCCATCCCTGCCCCTGACAGCAAG
AGACAGAGCATCCTGTTTTCCACTGAAGTC


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR222863 representing NM_001081412
Red=Cloning site Green=Tags(s)

MVDSVGFAEAWRAQFPDSEPPRMELRSVGDIEQELERCKASIRRLEQEVNQERFRMIYLQTLLAKEKKSY
DRQRWGFRRAAQPPDGAAEPRASAPRPPPAPADGADPAPVEESEARPDGEGSPSKGRSASARRPAAAASA
DRDDRGPPTSVAALRSNFEKIRKGPAQPGSADAEKPFYVNVEFHHERGLVKVNDKEVSDRISSLGSQAMQ
MERKKSQQSAGQGLGEAPRPHYRGRSSESSCGLDGDYEDAELNPRFLKDNLINANGGNRPPWPPLEYQPY
QSIYVGGMMVEGEGKSPLLRSQSTSEQEKRLTWPRRSYSPRSFEDSGGGYTPDCSSNENLTSSEEDFSSG
QSSRVSPSPTTYRMFRDKSRSPSQNSQQSFDSSSPPTPQCQKRHRQCQVVVSEATIVGVRKTGQIWPSDG
DSTFQGEADSSFGTPPGYGCAADQAEEQRRHQDGLPYIDDSPSSSPHLSSKGRGSLASGALDPTKVSELD
LEKGLEMRKWVLSGILASEETYLSHLEALLLPMKPLKAAATTSQPVLTSQQIETIFFKVPELYEIHKEFY
DGLFPRVQQWSHQQRVGDLFQKLASQLGVYRAFVDNYGVAMETAEKCCQANAQFAEISENLRARSNKDVK
DSTTKNSLETLLYKPVDRVTRSTLVLHDLLKHTPSSHPDHSLLQDALRISQNFLSSINEEITPRRQSMTV
KKGEHRQLLKDSFMVELVEGARKLRHIFLFTDLLLCTKLKKQSGGKTQQYDCKWYIPLTDLSFQMVDELE
ALPNIPLVPDEELDALKIKISQIKSDIQREKRANKGSKVMERLRKKLSEQESLLLLMSPSMAFRVHSRNG
KSYTFLISSDYERAEWRESIREQQKKCFKSFSLTSVELQMLTNSCVKLQTVHHIPLTINKEDDESPGLYG
FLHVIVHSATGFKQSSNLYCTLEVDSFGYFVNKAKTRVYRDTTEPNWNEEFEIELEGSQTLRILCYEKCY
NKMKMTKEDGESADKLMGKGQVQLDPQTLQDRDWQRTVIDMNGIEVKLSVKFTSREFSLKRMPSRKQTGV
FGVKIAVVTKRERSKVPYIVRQCVEEIERRGMEEVGIYRVSGVATDIQALKAAFDVNNKDVSVMMSEMDV
NAIAGTLKLYFRELPEPLFTDEFYPNFAEGIALSDPVAKESCMLNLLLSLPEANLLTFLFLLDHLKRVAE
KETVNKMSLHNLATVFGPTLLRPSEKESKLPANPSQPITMTDSWSLEVMSQVQVLLYFLQLEAIPAPDSK
RQSILFSTEV

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Sequencher program is needed, download here.
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_001081412
ORF Size 3810 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_001081412.1, NM_001081412.2, NP_001074881
RefSeq Size 6537
RefSeq ORF 3813
Locus ID 110279
Cytogenetics 10 C1|10 38.49 cM
MW 143.5 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations