Hist1h1a (NM_030609) Mouse Tagged ORF Clone

CAT#: MR222328

Hist1h1a (Myc-DDK-tagged) - Mouse histone cluster 1, H1a (Hist1h1a)

Clone Modification / Custom Cloning Service

  • TrueORF®

USD 219.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Hist1h1a (NM_030609) Mouse Tagged ORF Clone
Symbol Hist1h1a
Synonyms H1.1; H1a; H1f1; H1var3
Vector pCMV6-Entry
Sequence Data
>MR222328 representing NM_030609
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCGGAGACGGCGCCAGTCGCTCAGGCTGCTTCTACTGCCACGGAGAAACCTGCTGCTGCAAAGAAGA
CCAAGAAGCCGGCAAAAGCTGCCGCTCCTCGGAAGAAGCCCGCGGGACCTTCGGTGTCGGAGCTCATCGT
GCAGGCAGTTTCTTCTTCCAAAGAGCGCAGTGGCGTGTCCTTGGCCGCGCTCAAGAAGTCGCTGGCTGCG
GCGGGATACGATGTGGAGAAGAACAACAGCCGCATCAAACTGGGGCTGAAAAGCCTGGTGAATAAAGGCA
CACTGGTGCAGACCAAGGGCACCGGCGCTGCTGGCTCTTTTAAGCTGAACAAGAAGGCTGAGTCCAAGGC
CATCACCACCAAGGTGTCAGTGAAGGCGAAAGCATCCGGGGCTGCTAAGAAACCTAAGAAGACTGCTGGG
GCTGCAGCTAAGAAGACTGTCAAGACTCCGAAGAAGCCCAAGAAGCCTGCAGTTTCCAAGAAGACTTCCA
AGAGCCCCAAGAAGCCGAAGGTGGTGAAGGCCAAGAAGGTAGCCAAAAGCCCTGCCAAGGCGAAGGCAGT
GAAGCCTAAGGCTTCCAAGGCGAAAGTGACAAAGCCAAAGACCCCAGCTAAGCCCAAGAAGGCAGCGCCC
AAGAAAAAG


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
>MR222328 representing NM_030609
Red=Cloning site Green=Tags(s)

MSETAPVAQAASTATEKPAAAKKTKKPAKAAAPRKKPAGPSVSELIVQAVSSSKERSGVSLAALKKSLAA
AGYDVEKNNSRIKLGLKSLVNKGTLVQTKGTGAAGSFKLNKKAESKAITTKVSVKAKASGAAKKPKKTAG
AAAKKTVKTPKKPKKPAVSKKTSKSPKKPKVVKAKKVAKSPAKAKAVKPKASKAKVTKPKTPAKPKKAAP
KKK

myc-FLAG tag
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_030609
ORF Size 639 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_030609.1, NM_030609.2, NM_030609.3, NP_085112
RefSeq Size 747
RefSeq ORF 642
Locus ID 80838
Cytogenetics 13|13 A3.1
MW 22.2 kDa
Gene Summary Histones are basic nuclear proteins responsible for nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene is intronless and encodes a replication-dependent histone that is a member of the histone H1 family. Transcripts from this gene lack polyA tails but instead contain a palindromic termination element. [provided by RefSeq, Aug 2015].
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)