Abca5 (NM_147219) Mouse Tagged ORF Clone

CAT#: MR222272

Abca5 (Myc-DDK-tagged) - Mouse ATP-binding cassette, sub-family A (ABC1), member 5 (Abca5)

Change vector?

  • TrueORF®

USD 2,091.00


Availability*
In Stock

Size
    • 10 ug

Product images

Specifications

Product Data
Product Name Abca5 (NM_147219) Mouse Tagged ORF Clone
Symbol Abca5
Synonyms ABC13; B930033A02Rik; mKIAA1888
Vector pCMV6-Entry
Sequence Data
ORF Nucleotide Sequence
>MR222272 representing NM_147219
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGCTACTGCAATTAGGGATGTGGGAGTTTGGAGACAGACCAGAACACTTCTACTGAAAAATTACCTAA
TTAAATGCAGGACTAAAAAAAGTAGTGTTCAGGAAATTCTTTTTCCTCTATTTTTCTTATTTTGGCTGAT
ATTAGTTAGCATGATGCATCCAAATAAGAAATATGAAGAGGTATCTGATATAGAGCTCAGCCCTATGGAC
AAATTCAGCCTTTCCAACGTTATTCTTGGATACACTCCCGTGACTAACATTACAAGCAGCATTATGCAGA
GGGTTTCTACCGATCATCTTCCCAAGGTTATAGTTACTGAAGAATACGCAAATGAGAAAGAACTGGTAGC
CGCAAGTCTTTCTAAGTCCAGCAACTTCGTAGGTGTGGTTTTCAAAGACACCATGTCCTATGAACTTCGT
TTTTTTCCTGAAATGATTCCAGTGTCTTCTATTTATATGAATTCAAGAGAAGGCTGTTCAAAGACATGTG
ATGCTGCTCAGTACTGGTCTTTGGGGTTTACAGTTCTGCAGGCATCGATAGATGCTGCCATTATACAGCT
GAAGACCAATGTTTCTGTGTGGAGCGAGCTGGAGTCGACCAAAGCTGTGATCATGGGAGAGGCCGCTGTT
GTGGAGATTGACACCTTCCCGCGAGGGGTCATCCTCATCTACCTCGTCATAGCCTTCTCGCCCTTCGGCT
ACTTCCTGGCAATCCACATCGTGGCAGAAAAAGAAAAGAAGTTAAAGGAATTTTTAAAGATAATGGGACT
TCATGACACTGCTTTTTGGCTTTCCTGGGTTCTTCTGTACGCAAGCTTGATTTTCCTTATGTCCCTGCTT
ATGGCTGTCATCGCAACAGCTTCTTCGTTATTCCCTCAGAGTAGCAGCATTGTGATCTTTCTACTGTTCT
TCTTATATGGATTGTCATCTGTGTTTTTTGCTTTAATGCTGACGCCTCTTTTTAAAAAATCAAAACACGT
GGGAGTCGTTGAGTTTTTTGTCACCGTGGTGTTTGGATTTGTTGGCCTGCTGATTGTCCTCATAGAAAGT
TTCCCCAGGTCGCTGGTGTGGCTCTTCAGTCCTTTGTGTCAGTGTGCCTTTCTGATTGGGATTGCACAGG
TCATGCATTTAGAAGATTTTAATGAGGGTGCCTTATTTTCTAATTTGACTGAAGGTCCCTATCCTCTAAT
TATTACTATTATCATGCTAGCTCTTGACAGTGTGTTCTATGTCCTCCTGGCTGTGTATCTCGACCAAGTC
ATTCCAGGGGAATTTGGCTTGAGGAGGTCATCTTTGTATTTTTTGAAGCCATCGTATTGGTCAAAAAACA
AAAGAAACTATAAGGAGCTATCGGAGGGCAACATTAATGGCAATATTAGTCTCAATGAAATTGTTGAGCC
CGTTTCTTCAGAATTTATAGGGAAAGAAGCTATAAGAATAAGTGGTATTCAGAAATCCTATAGAAAGAAA
ACTGAGAACGTGGAGGCTTTGAGAAATTTGTCATTTGACATATATGAAGGTCAGATTACTGCACTGCTGG
GCCACAGTGGAACAGGAAAAAGCACACTGATGAATATTCTGTGTGGACTGTGTCCACCCTCTGATGGGTT
TGCTTCTATATATGGACACAGAGTCTCTGAAATAGATGAAATGTTTGAAGCAAGAAAAATGATTGGCATA
TGTCCGCAGTCAGATATAAACTTTGATGTTCTGACAGTAGAAGAAAATTTATCAATTTTGGCTTCAATCA
AAGGAATACCAGCCAACAATATAATTCAAGAAGTGCAGAAAGTGTTGCTGGATCTGGACATGCAAGCCAT
CAAAGATAATCAAGCGAAAAAGTTAAGCGGTGGTCAGAAAAGGAAGCTGTCTGTAGGAATTGCAGTTCTC
GGGAATCCAAAGATACTCCTGCTAGACGAGCCTACAGCAGGAATGGACCCCTGCTCTCGCCATATTGTTT
GGAATCTTCTAAAGTATAGAAAGGCTAACAGAGTGACCGTGTTTAGTACTCACTTCATGGATGAGGCTGA
CATTCTTGCCGACAGGAAAGCTGTCATATCACAAGGAATGCTGAAGTGTGTTGGTTCTTCAATTTTCCTA
AAGAGTAAATGGGGAATCGGCTACCGCCTGAGCATGTATATAGACAGATACTGTGCCACAGAGTCACTGT
CGTCGCTGGTTAGGCAGCACATACCCGCAGCCGCGCTACTGCAGCAGAATGACCAGCAGCTCGTGTACAG
CCTGCCTTTCAAAGACATGGACAAATTTTCAGGCTTGTTTTCTGCTCTAGACATTCATTCAAACCTGGGT
GTTATTTCTTATGGTGTTTCCATGACAACATTGGAAGATGTATTCTTAAAGCTAGAAGTTGAAGCAGAAA
TTGACCAAGCAGACTATAGTGTATTTACACAGCAGCCGCGGGAGGAAGAAACAGATTCAAAATCCTTTGA
TGAAATGGAACAGAGTTTACTTATTCTCTCTGAAACGAAAGCTTCTTCAGTGAGCACCATGAGCCTCTGG
AAGCAGCAAGTGTCTACGATTGCAAAGTTTCATTTCCTCTCATTGAAACGAGAAAGCAAATCAGTGCGCG
CTGTGTTGCTTCTGCTTTTAATTTTTTTTGCAGTTCAGATTTTTATGTTTTTTCTCCATCATTCTTTTAA
AAATGCTGTGGTTCCCATCAAACTCGTTCCAGACTTGTATTTCCTAAAGCCTGGAGATAAACCTCATAAA
TACAAAACAAGCCTGCTGCTTCAAAATTCTACTGACTCAGATATCAATGGTCTTATTGAGTTTTTTGCAC
ACCAGAACATAATGGTGGCAATGTTTAATGACAGTGACTATGTGTCTGCTGCTCCTCACAGTGCGGCTCT
CAATGTGGTGCGTTCTGAAAAGGACTATGTTTTTTCTGCTGTTTTCAACAGTACTATGGTTTATTGTTTG
CCAGTCATGATGAACATCATTAGTAACTACTATCTTTATCATTTAAATGTGACTGAAGCCATCCAGACCT
GGAGTACCCCGTTCATTCAAGAAATTACTGACATTGTTTTTAAAATTGAGCTATATTTTCAAGCAGCTTT
GCTTGGAATCATTGTTACTGCAATGCCACCTTACTTTGCCATGGAAAATGCAGAGAATCATAAGATCAAA
GCTTATACTCAACTTAAACTTTCGGGTCTTTTGCCATCAGCCTATTGGGTTGGACAAGCTGTTGTGGATA
TTCCCTTGTTTTTTGTTGTTCTGATTTTGATGCTGGGAAGTTTATTTGCATTTCATCATGGACTGTATTT
TTATCCTGCAAAATTTCTTGCTGTGGTGTTTTGCCTCATTGCTTATGTGCCCTCCGTCATTCTGTTCACG
TACATAGCTTCGTTCACTTTCAAGAAAATTTTAAATACCAAGGAATTTTGGTCATTTATCTATTCTGTGA
CCGCATTGGCTTGTGTGGCAATCACGGAAACAACTTTCTTTCTGCAATATGCAGTTACGGCTGTCTTTCA
TTACACCTTCTGCATAGCCATTCCAATCTACCCTCTCCTGGGTTGTCTGATTTCTTTCATAAAGGGTTCT
TGGAAGAATATGCCAAAAAATGAGAATACCTACAATCCCTGGGATAGACTTTTAGTTGCTGTAATCATGC
CCTACCTGCAGTGTATACTGTGGATTTTCCTCTTACAACACTATGAGAAAATACATGGAGGCAGATCTAT
AAGAAAGGATCCATTTTTCAGGGCCCTTTCACAAAAGGCCAAAAATAAGAAGTTTCCAGAACCACCCATC
AATGAGGATGAAGATGAAGATGTCAAAGCTGAAAGACTGAAGGTTAAAGAGCTGATGGGTTGCCAGTGTT
GTGAGGAGAAGCCAGCCATTATGGTATGCAATTTGCATAAAGAGTATGATGACAAGAAAGATTTTCTTCA
TTCAAGAAAAACAACAAAAGTAGCAACAAAATACATCTCTTTCTGTGTGAAAAAAGGAGAGATCTTGGGA
CTGTTGGGTCCAAATGGAGCTGGCAAAAGCACAGTCATTAACACTCTGGTTGGGGACGTTGAGCCAACTT
CAGGCAAGATCTTTCTAGGAGATTATGGTTCACATTCAAGTGAAGATGACGAATCCATTAAGTGTATGGG
GTACTGCCCCCAGACAAACCCACTGTGGCCAGATCTCACTCTACAGGAACATTTTGAGATTTACGGAGCT
GTGAAAGGAATGAGTCCTGGTGACATGAAGGAAGTCATCAGTCGAATAACAAAAGCCCTTGATTTGAAAG
AACATCTTCAGAAGACTGTAAAGAAGCTACCTGCAGGGATCAAGCGAAAGCTGTGTTTTGCTCTCAGCAT
GCTGGGGAACCCTCAGGTGACGCTGCTGGATGAGCCGTCCACAGGCATGGACCCAAGAGCCAAGCAGCAC
ATGTGGAGAGCTATTCGAACTGCATTTAAAAACAAAAAGCGGGCCGCCCTCCTGACTACTCATTACATGG
AAGAGGCAGAGGCTGTCTGTGACAGAGTGGCCATCATGGTATCTGGGCAGCTAAGATGTATTGGAACAGT
ACAACATCTAAAGAGTAAGTTTGGTAAAGGCTACTTTTTGGAAATTAAATTAAAGGACTGGATAGAAAAC
CTGGAAATAGATCGCCTTCAAAGAGAAATTCAATATATTTTCCCAAATGCAAGCCGCCAAGAGAGCTTTT
CTTCTATTTTGGCTTTTAAAATTCCAAAAGAAGATGTTCAGTCTCTCTCACAATCCTTCGCTAAGTTGGA
AGAAGCAAAACGCACTTTTGCCATTGAAGAATACAGCTTTTCTCAAGCAACCCTGGAACAGGTTTTTGTA
GAACTTACTAAAGAGCAAGAGGAAGAAGATAACAGCTGTGGGACTTTGGCCAGCACTCTCTGGTGGGAAA
GGACGCAGGAGGATAGAGTAGTATTT


ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT
ACAAGGATGACGACGATAAG
GTTTAA
Protein Sequence
>MR222272 representing NM_147219
Red=Cloning site Green=Tags(s)

MATAIRDVGVWRQTRTLLLKNYLIKCRTKKSSVQEILFPLFFLFWLILVSMMHPNKKYEEVSDIELSPMD
KFSLSNVILGYTPVTNITSSIMQRVSTDHLPKVIVTEEYANEKELVAASLSKSSNFVGVVFKDTMSYELR
FFPEMIPVSSIYMNSREGCSKTCDAAQYWSLGFTVLQASIDAAIIQLKTNVSVWSELESTKAVIMGEAAV
VEIDTFPRGVILIYLVIAFSPFGYFLAIHIVAEKEKKLKEFLKIMGLHDTAFWLSWVLLYASLIFLMSLL
MAVIATASSLFPQSSSIVIFLLFFLYGLSSVFFALMLTPLFKKSKHVGVVEFFVTVVFGFVGLLIVLIES
FPRSLVWLFSPLCQCAFLIGIAQVMHLEDFNEGALFSNLTEGPYPLIITIIMLALDSVFYVLLAVYLDQV
IPGEFGLRRSSLYFLKPSYWSKNKRNYKELSEGNINGNISLNEIVEPVSSEFIGKEAIRISGIQKSYRKK
TENVEALRNLSFDIYEGQITALLGHSGTGKSTLMNILCGLCPPSDGFASIYGHRVSEIDEMFEARKMIGI
CPQSDINFDVLTVEENLSILASIKGIPANNIIQEVQKVLLDLDMQAIKDNQAKKLSGGQKRKLSVGIAVL
GNPKILLLDEPTAGMDPCSRHIVWNLLKYRKANRVTVFSTHFMDEADILADRKAVISQGMLKCVGSSIFL
KSKWGIGYRLSMYIDRYCATESLSSLVRQHIPAAALLQQNDQQLVYSLPFKDMDKFSGLFSALDIHSNLG
VISYGVSMTTLEDVFLKLEVEAEIDQADYSVFTQQPREEETDSKSFDEMEQSLLILSETKASSVSTMSLW
KQQVSTIAKFHFLSLKRESKSVRAVLLLLLIFFAVQIFMFFLHHSFKNAVVPIKLVPDLYFLKPGDKPHK
YKTSLLLQNSTDSDINGLIEFFAHQNIMVAMFNDSDYVSAAPHSAALNVVRSEKDYVFSAVFNSTMVYCL
PVMMNIISNYYLYHLNVTEAIQTWSTPFIQEITDIVFKIELYFQAALLGIIVTAMPPYFAMENAENHKIK
AYTQLKLSGLLPSAYWVGQAVVDIPLFFVVLILMLGSLFAFHHGLYFYPAKFLAVVFCLIAYVPSVILFT
YIASFTFKKILNTKEFWSFIYSVTALACVAITETTFFLQYAVTAVFHYTFCIAIPIYPLLGCLISFIKGS
WKNMPKNENTYNPWDRLLVAVIMPYLQCILWIFLLQHYEKIHGGRSIRKDPFFRALSQKAKNKKFPEPPI
NEDEDEDVKAERLKVKELMGCQCCEEKPAIMVCNLHKEYDDKKDFLHSRKTTKVATKYISFCVKKGEILG
LLGPNGAGKSTVINTLVGDVEPTSGKIFLGDYGSHSSEDDESIKCMGYCPQTNPLWPDLTLQEHFEIYGA
VKGMSPGDMKEVISRITKALDLKEHLQKTVKKLPAGIKRKLCFALSMLGNPQVTLLDEPSTGMDPRAKQH
MWRAIRTAFKNKKRAALLTTHYMEEAEAVCDRVAIMVSGQLRCIGTVQHLKSKFGKGYFLEIKLKDWIEN
LEIDRLQREIQYIFPNASRQESFSSILAFKIPKEDVQSLSQSFAKLEEAKRTFAIEEYSFSQATLEQVFV
ELTKEQEEEDNSCGTLASTLWWERTQEDRVVF

myc-FLAG tag
Chromatograms CHROMATOGRAMS
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
Tag Myc-DDK
ACCN NM_147219
ORF Size 4926 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified, transfection-ready dried plasmid DNA, and shipped with 2 vector sequencing primers.
Reference Data
RefSeq NM_147219.1, NM_147219.2, NP_671752
RefSeq Size 8339
Locus ID 217265
Cytogenetics 11|11 E1
MW 186.3 kDa
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.